Recombinant Human ALK and LTK ligand 2 (ALKAL2) | CSB-BP740918HU

(No reviews yet) Write a Review
SKU:
CSB-BP740918HU
Availability:
3 - 7 Working Days
€443.00 - €1,472.00

Description

Recombinant Human ALK and LTK ligand 2 (ALKAL2) | CSB-BP740918HU | Cusabio

Alternative Name(s): Augmentor alpha (AUG-alpha) (Protein FAM150B) (FAM150B)

Gene Names: ALKAL2

Research Areas: Others

Organism: Homo sapiens (Human)

AA Sequence: GAEPREPADGQALLRLVVELVQELRKHHSAEHKGLQLLGRDCALGRAEAAGLGPSPEQRVEIVPRDLRMKDKFLKHLTGPLYFSPKCSKHFHRLYHNTRDCTIPAYYKRCARLLTRLAVSPVCMEDKQ

Source: Baculovirus

Tag Info: N-terminal 10xHis-tagged and C-terminal Myc-tagged

Expression Region: 25-152aa

Sequence Info: Full Length of Mature Protein

MW: 18.4

Purity: Greater than 85% as determined by SDS-PAGE.

Relevance: Ligand for receptor tyrosine kinases LTK and ALK. Stimulation of ALK signaling may be involved in regulation of cell proliferation and transformation

Reference: "ALKALs are in vivo ligands for ALK family receptor tyrosine kinases in the neural crest and derived cells." Fadeev A., Mendoza-Garcia P., Irion U., Guan J., Pfeifer K., Wiessner S., Serluca F., Singh A.P., Nusslein-Volhard C., Palmer R.H. Proc. Natl. Acad. Sci. U.S.A. 115:E630-E638(2018)

Storage: The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20?/-80?. The shelf life of lyophilized form is 12 months at -20?/-80?.

Notes: Repeated freezing and thawing is not recommended. Store working aliquots at 4? for up to one week.

Function:

Involvement in disease:

Subcellular Location:

Protein Families:

Tissue Specificity:

Paythway:

Form: Liquid or Lyophilized powder

Buffer: If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0.

Reconstitution: We recommend that this vial be briefly centrifuged prior to opening to bring the contents to the bottom. Please reconstitute protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL.We recommend to add 5-50% of glycerol (final concentration) and aliquot for long-term storage at -20?/-80?. Our default final concentration of glycerol is 50%. Customers could use it as reference.

Uniprot ID: Q6UX46

HGNC Database Link: N/A

UniGene Database Link: N/A

KEGG Database Link: N/A

STRING Database Link: N/A

OMIM Database Link: N/A

View AllClose

0 Reviews

View AllClose