Recombinant Human Aldo-keto reductase family 1 member C2 (AKR1C2) | CSB-EP001543HU

(No reviews yet) Write a Review
SKU:
CSB-EP001543HU
Availability:
3 - 7 Working Days
  • Recombinant Human Aldo-keto reductase family 1 member C2 (AKR1C2)
  • (Tris-Glycine gel) Discontinuous SDS-PAGE (reduced) with 5% enrichment gel and 15% separation gel.
$294.00 - $1,532.40

Description

Recombinant Human Aldo-keto reductase family 1 member C2 (AKR1C2) | CSB-EP001543HU | Cusabio

Alternative Name(s): 3-alpha-HSD;3Chlordecone reductase homolog HAKRD;Dihydrodiol dehydrogenase 2 ;DD-2 ;DD2Dihydrodiol dehydrogenase/bile acid-binding protein ;DD/BABPTrans-1,2-dihydrobenzene-1,2-diol dehydrogenase (EC:1.3.1.20);Type III 3-alpha-hydroxysteroid dehydrogenase (EC:1.1.1.357)

Gene Names: AKR1C2

Research Areas: Metabolism

Organism: Homo sapiens (Human)

AA Sequence: MDSKYQCVKLNDGHFMPVLGFGTYAPAEVPKSKALEAVKLAIEAGFHHIDSAHVYNNEEQVGLAIRSKIADGSVKREDIFYTSKLWSNSHRPELVRPALERSLKNLQLDYVDLYLIHFPVSVKPGEEVIPKDENGKILFDTVDLCATWEAMEKCKDAGLAKSIGVSNFNHRLLEMILNKPGLKYKPVCNQVECHPYFNQRKLLDFCKSKDIVLVAYSALGSHREEPWVDPNSPVLLEDPVLCALAKKHKRTPALIALRYQLQRGVVVLAKSYNEQRIRQNVQVFEFQLTSEEMKAIDGLNRNVRYLTLDIFAGPPNYPFSDEY

Source: E.coli

Tag Info: N-terminal 6xHis-SUMO-tagged

Expression Region: 1-323aa

Sequence Info: Full Length

MW: 52.7 kDa

Purity: Greater than 90% as determined by SDS-PAGE.

Relevance: Works in concert with the 5-alpha/5-beta-steroid reductases to convert steroid hormones into the 3-alpha/5-alpha and 3-alpha/5-beta-tetrahydrosteroids. Catalyzes the inactivation of the most potent androgen 5-alpha-dihydrotestosterone (5-alpha-DHT) to 5-alpha-androstane-3-alpha,17-beta-diol (3-alpha-diol). Has a high bile-binding ability.

Reference: Molecular cloning of multiple cDNAs encoding human enzymes structurally related to 3 alpha-hydroxysteroid dehydrogenase.Qin K.-N., New M.I., Cheng K.-C.J. Steroid Biochem. Mol. Biol. 46:673-679(1993)

Storage: The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20?/-80?. The shelf life of lyophilized form is 12 months at -20?/-80?.

Notes: Repeated freezing and thawing is not recommended. Store working aliquots at 4? for up to one week.

Function: Works in concert with the 5-alpha/5-beta-steroid reductases to convert steroid hormones into the 3-alpha/5-alpha and 3-alpha/5-beta-tetrahydrosteroids. Catalyzes the inactivation of the most potent androgen 5-alpha-dihydrotestosterone (5-alpha-DHT) to 5-alpha-androstane-3-alpha,17-beta-diol (3-alpha-diol). Has a high bile-binding ability.

Involvement in disease: 46,XY sex reversal 8 (SRXY8)

Subcellular Location: Cytoplasm

Protein Families: Aldo/keto reductase family

Tissue Specificity: Expressed in fetal testes. Expressed in fetal and adult adrenal glands.

Paythway:

Form: Liquid or Lyophilized powder

Buffer: If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0.

Reconstitution: We recommend that this vial be briefly centrifuged prior to opening to bring the contents to the bottom. Please reconstitute protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL.We recommend to add 5-50% of glycerol (final concentration) and aliquot for long-term storage at -20?/-80?. Our default final concentration of glycerol is 50%. Customers could use it as reference.

Uniprot ID: P52895

HGNC Database Link: HGNC

UniGene Database Link: UniGene

KEGG Database Link: KEGG

STRING Database Link: STRING

OMIM Database Link: OMIM

View AllClose

0 Reviews

View AllClose