Recombinant Human Alba-like protein C9orf23 (C9orf23) | CSB-EP822707HU

(No reviews yet) Write a Review
SKU:
CSB-EP822707HU
Availability:
13 - 23 Working Days
  • Recombinant Human Alba-like protein C9orf23 (C9orf23)
  • (Tris-Glycine gel) Discontinuous SDS-PAGE (reduced) with 5% enrichment gel and 15% separation gel.
$357.60 - $2,042.40

Description

Recombinant Human Alba-like protein C9orf23 (C9orf23) | CSB-EP822707HU | Cusabio

Alternative Name(s): Rpp25-like protein

Gene Names: RPP25L

Research Areas: Cell Biology

Organism: Homo sapiens (Human)

AA Sequence: MEHYRKAGSVELPAPSPMPQLPPDTLEMRVRDGSKIRNLLGLALGRLEGGSARHVVFSGSGRAAGKAVSCAEIVKRRVPGLHQLTKLRFLQTEDSWVPASPDTGLDPLTVRRHVPAVWVLLSRDPLDPNECGYQPPGAPPGLGSMPSSSCGPRSRRRARDTRS

Source: E.coli

Tag Info: N-terminal GST-tagged

Expression Region: 1-163aa

Sequence Info: Full Length

MW: 44.6 kDa

Purity: Greater than 90% as determined by SDS-PAGE.

Relevance: May be a component of ribonuclease P or MRP.

Reference: "Inventory and analysis of the protein subunits of the ribonucleases P and MRP provides further evidence of homology between the yeast and human enzymes." Rosenblad M.A., Lopez M.D., Piccinelli P., Samuelsson T. Nucleic Acids Res. 34:5145-5156(2006)

Storage: The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20?/-80?. The shelf life of lyophilized form is 12 months at -20?/-80?.

Notes: Repeated freezing and thawing is not recommended. Store working aliquots at 4? for up to one week.

Function: May be a component of ribonuclease P or MRP.

Involvement in disease:

Subcellular Location: Nucleus

Protein Families: Histone-like Alba family

Tissue Specificity:

Paythway:

Form: Liquid or Lyophilized powder

Buffer: If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0.

Reconstitution: We recommend that this vial be briefly centrifuged prior to opening to bring the contents to the bottom. Please reconstitute protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL.We recommend to add 5-50% of glycerol (final concentration) and aliquot for long-term storage at -20?/-80?. Our default final concentration of glycerol is 50%. Customers could use it as reference.

Uniprot ID: Q8N5L8

HGNC Database Link: HGNC

UniGene Database Link: UniGene

KEGG Database Link: KEGG

STRING Database Link: STRING

OMIM Database Link: N/A

View AllClose

0 Reviews

View AllClose