Recombinant Human ADP-ribosylation factor 6 (ARF6) | CSB-EP001996HU

Recombinant Human ADP-ribosylation factor 6 (ARF6) | CSB-EP001996HU | Cusabio

Alternative Name(s): ADP ribosylation factor 6 ; ADP ribosylation factor protein 6; ADP-ribosylation factor 6; ARF6; ARF6_HUMAN; DKFZp564M0264; Small GTP binding protein ; Small GTPase

Gene Names: ARF6

Research Areas: Developmental Biology

Organism: Homo sapiens (Human)

AA Sequence: MGKVLSKIFGNKEMRILMLGLDAAGKTTILYKLKLGQSVTTIPTVGFNVETVTYKNVKFNVWDVGGQDKIRPLWRHYYTGTQGLIFVVDCADRDRIDEARQELHRIINDREMRDAIILIFANKQDLPDAMKPHEIQEKLGLTRIRDRNWYVQPSCATSGDGLYEGLTWLTSNYKS

Source: E.coli

Tag Info: N-terminal 6xHis-SUMO-tagged

Expression Region: 1-175aa

Sequence Info: Full Length

MW: 36.1 kDa

Purity: Greater than 90% as determined by SDS-PAGE.

Relevance: GTP-binding protein involved in protein trafficking that regulates endocytic recycling and cytoskeleton rodeling. Required for normal completion of mitotic cytokinesis. Plays a role in the reorganization of the actin cytoskeleton and the formation of stress fibers. May also modulate vesicle budding and uncoating within the Golgi apparatus. Involved in the regulation of dendritic spine development, contributing to the regulation of dendritic branching and filopodia extension. Functions as an allosteric activator of the cholera toxin catalytic subunit, an ADP-ribosyltransferase

Reference: Structural basis for membrane recruitment and allosteric activation of cytohesin family Arf GTPase exchange factors.Malaby A.W., van den Berg B., Lambright D.G.Proc. Natl. Acad. Sci. U.S.A. 110:14213-14218(2013)

Storage: The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20?/-80?. The shelf life of lyophilized form is 12 months at -20?/-80?.

Notes: Repeated freezing and thawing is not recommended. Store working aliquots at 4? for up to one week.

Function: GTP-binding protein involved in protein trafficking that regulates endocytic recycling and cytoskeleton remodeling. Required for normal completion of mitotic cytokinesis. Plays a role in the reorganization of the actin cytoskeleton and the formation of stress fibers. May also modulate vesicle budding and uncoating within the Golgi apparatus. Involved in the regulation of dendritic spine development, contributing to the regulation of dendritic branching and filopodia extension. Involved in epithelial polarization (By similarity).Functions as an allosteric activator of the cholera toxin catalytic subunit, an ADP-ribosyltransferase.

Involvement in disease:

Subcellular Location: Cytoplasm, cytosol, Cell membrane, Lipid-anchor, Endosome membrane, Lipid-anchor, Recycling endosome membrane, Lipid-anchor, Cell projection, filopodium membrane, Lipid-anchor, Cell projection, ruffle, Cleavage furrow, Midbody, Midbody ring, Golgi apparatus

Protein Families: Small GTPase superfamily, Arf family

Tissue Specificity: Ubiquitous, with higher levels in heart, substantia nigra, and kidney.

Paythway: Rassignalingpathway

Form: Liquid or Lyophilized powder

Buffer: If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0.

Reconstitution: We recommend that this vial be briefly centrifuged prior to opening to bring the contents to the bottom. Please reconstitute protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL.We recommend to add 5-50% of glycerol (final concentration) and aliquot for long-term storage at -20?/-80?. Our default final concentration of glycerol is 50%. Customers could use it as reference.

Uniprot ID: P62330

HGNC Database Link: HGNC

UniGene Database Link: UniGene

KEGG Database Link: KEGG

STRING Database Link: STRING

OMIM Database Link: OMIM