Recombinant Human Adenine phosphoribosyltransferase (APRT) | CSB-EP001954HU

(No reviews yet) Write a Review
SKU:
CSB-EP001954HU
Availability:
13 - 23 Working Days
  • Recombinant Human Adenine phosphoribosyltransferase (APRT)
  • (Tris-Glycine gel) Discontinuous SDS-PAGE (reduced) with 5% enrichment gel and 15% separation gel.
£196.00 - £1,021.60

Description

Recombinant Human Adenine phosphoribosyltransferase (APRT) | CSB-EP001954HU | Cusabio

Alternative Name(s): Adenine phosphoribosyltransferase; AMP; AMP diphosphorylase; AMP pyrophosphorylase; APRT; APT_HUMAN; DKFZp686D13177; MGC125856; MGC125857; MGC129961; Transphosphoribosidase

Gene Names: APRT

Research Areas: Signal Transduction

Organism: Homo sapiens (Human)

AA Sequence: ADSELQLVEQRIRSFPDFPTPGVVFRDISPVLKDPASFRAAIGLLARHLKATHGGRIDYIAGLDSRGFLFGPSLAQELGLGCVLIRKRGKLPGPTLWASYSLEYGKAELEIQKDALEPGQRVVVVDDLLATGGTMNAACELLGRLQAEVLECVSLVELTSLKGREKLAPVPFFSLLQYE

Source: E.coli

Tag Info: N-terminal GST-tagged

Expression Region: 1-180aa

Sequence Info: Full Length

MW: 46.5 kDa

Purity: Greater than 90% as determined by SDS-PAGE.

Relevance: Catalyzes a salvage reaction resulting in the formation of AMP, that is energically less costly than de novo synthesis.

Reference: "Comparative anatomy of the human APRT gene and enzyme: nucleotide sequence divergence and conservation of a nonrandom CpG dinucleotide arrangement." Broderick T.P., Schaff D.A., Bertino A.M., Dush M.K., Tischfield J.A., Stambrook P.J. Proc. Natl. Acad. Sci. U.S.A. 84:3349-3353(1987)

Storage: The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20?/-80?. The shelf life of lyophilized form is 12 months at -20?/-80?.

Notes: Repeated freezing and thawing is not recommended. Store working aliquots at 4? for up to one week.

Function: Catalyzes a salvage reaction resulting in the formation of AMP, that is energically less costly than de novo synthesis.

Involvement in disease: Adenine phosphoribosyltransferase deficiency (APRTD)

Subcellular Location: Cytoplasm

Protein Families: Purine/pyrimidine phosphoribosyltransferase family

Tissue Specificity:

Paythway:

Form: Liquid or Lyophilized powder

Buffer: If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0.

Reconstitution: We recommend that this vial be briefly centrifuged prior to opening to bring the contents to the bottom. Please reconstitute protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL.We recommend to add 5-50% of glycerol (final concentration) and aliquot for long-term storage at -20?/-80?. Our default final concentration of glycerol is 50%. Customers could use it as reference.

Uniprot ID: P07741

HGNC Database Link: HGNC

UniGene Database Link: UniGene

KEGG Database Link: KEGG

STRING Database Link: STRING

OMIM Database Link: OMIM

View AllClose

0 Reviews

View AllClose