Recombinant Human Activating signal cointegrator 1 complex subunit 3 (ASCC3) | CSB-EP002198HU

(No reviews yet) Write a Review
SKU:
CSB-EP002198HU
Availability:
13 - 23 Working Days
  • Recombinant Human Activating signal cointegrator 1 complex subunit 3 (ASCC3)
  • (Tris-Glycine gel) Discontinuous SDS-PAGE (reduced) with 5% enrichment gel and 15% separation gel.
$319.20 - $1,728.00

Description

Recombinant Human Activating signal cointegrator 1 complex subunit 3 (ASCC3) | CSB-EP002198HU | Cusabio

Alternative Name(s): ASC-1 complex subunit p200

Gene Names: ASCC3

Research Areas: Others

Organism: Homo sapiens (Human)

AA Sequence: MALPRLTGALRSFSNVTKQDNYNEEVADLKIKRSKLHEQVLDLGLTWKKIIKFLNEKLEKSKMQSINEDLKDILHAAKQIEVNCPFQKRRLDGKEEDEKMSRASDRFRGLR

Source: E.coli

Tag Info: N-terminal GST-tagged

Expression Region: 1-111aa

Sequence Info: Full Length of Isoform 2

MW: 40 kDa

Purity: Greater than 90% as determined by SDS-PAGE.

Relevance: 3'-5' DNA helicase involved in repair of alkylated DNA. Promotes DNA unwinding to generate single-stranded substrate needed for ALKBH3, enabling ALKBH3 to process alkylated N3-methylcytosine (3mC) within double-stranded regions. Enhances NF-kappa-B, SRF and AP1 transactivation.

Reference: "The immunodominant antigen recognized by autologous CTL on a human melanoma is generated by a point mutation in a new member of the RNA helicase gene family." Baurain J.-F. Submitted (FEB-1998)

Storage: The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20?/-80?. The shelf life of lyophilized form is 12 months at -20?/-80?.

Notes: Repeated freezing and thawing is not recommended. Store working aliquots at 4? for up to one week.

Function: 3'-5' DNA helicase involved in repair of alkylated DNA. Promotes DNA unwinding to generate single-stranded substrate needed for ALKBH3, enabling ALKBH3 to process alkylated N3-methylcytosine (3mC) within double-stranded regions. Enhances NF-kappa-B, SRF and AP1 transactivation.

Involvement in disease:

Subcellular Location: Nucleus

Protein Families: Helicase family

Tissue Specificity: Ubiquitous.

Paythway:

Form: Liquid or Lyophilized powder

Buffer: If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0.

Reconstitution: We recommend that this vial be briefly centrifuged prior to opening to bring the contents to the bottom. Please reconstitute protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL.We recommend to add 5-50% of glycerol (final concentration) and aliquot for long-term storage at -20?/-80?. Our default final concentration of glycerol is 50%. Customers could use it as reference.

Uniprot ID: Q8N3C0

HGNC Database Link: HGNC

UniGene Database Link: UniGene

KEGG Database Link: KEGG

STRING Database Link: STRING

OMIM Database Link: OMIM

View AllClose

0 Reviews

View AllClose