Recombinant Human Abhydrolase domain-containing protein 14B (ABHD14B) | CSB-EP842687HU

(No reviews yet) Write a Review
SKU:
CSB-EP842687HU
Availability:
13 - 23 Working Days
  • Recombinant Human Abhydrolase domain-containing protein 14B (ABHD14B)
  • (Tris-Glycine gel) Discontinuous SDS-PAGE (reduced) with 5% enrichment gel and 15% separation gel.
€245.00 - €1,277.00

Description

Recombinant Human Abhydrolase domain-containing protein 14B (ABHD14B) | CSB-EP842687HU | Cusabio

Alternative Name(s): ABHD14B; ABHEB_HUMAN; Abhydrolase domain containing 14B; Abhydrolase domain containing protein 14B; Abhydrolase domain-containing protein 14B; CCG1 interacting factor B; CCG1-interacting factor B; Cell cycle gene 1 interacting factor B; CIB; MGC15429; OTTHUMP00000212469

Gene Names: ABHD14B

Research Areas: Cell Biology

Organism: Homo sapiens (Human)

AA Sequence: AASVEQREGTIQVQGQALFFREALPGSGQARFSVLLLHGIRFSSETWQNLGTLHRLAQAGYRAVAIDLPGLGHSKEAAAPAPIGELAPGSFLAAVVDALELGPPVVISPSLSGMYSLPFLTAPGSQLPGFVPVAPICTDKINAANYASVKTPALIVYGDQDPMGQTSFEHLKQLPNHRVLIMKGAGHPCYLDKPEEWHTGLLDFLQGLQ

Source: E.coli

Tag Info: N-terminal 6xHis-SUMO-tagged

Expression Region: 2-210aa

Sequence Info: Full Length of Mature Protein

MW: 38.2 kDa

Purity: Greater than 90% as determined by SDS-PAGE.

Relevance:

Reference: "Initial characterization of the human central proteome."Burkard T.R., Planyavsky M., Kaupe I., Breitwieser F.P., Buerckstuemmer T., Bennett K.L., Superti-Furga G., Colinge J.BMC Syst. Biol. 5:17-17(2011)

Storage: The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20?/-80?. The shelf life of lyophilized form is 12 months at -20?/-80?.

Notes: Repeated freezing and thawing is not recommended. Store working aliquots at 4? for up to one week.

Function: Has hydrolase activity towards p-nitrophenyl butyrate (in vitro). May activate transcription.

Involvement in disease:

Subcellular Location: Cytoplasm, Nucleus

Protein Families: AB hydrolase superfamily, ABHD14 family

Tissue Specificity: Ubiquitous. Detected in spleen, thymus, prostate, testis, ovary, small intestine, colon, peripheral blood leukocyte, heart, placenta, lung, liver, skeletal muscle, pancreas and kidney.

Paythway:

Form: Liquid or Lyophilized powder

Buffer: If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0.

Reconstitution: We recommend that this vial be briefly centrifuged prior to opening to bring the contents to the bottom. Please reconstitute protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL.We recommend to add 5-50% of glycerol (final concentration) and aliquot for long-term storage at -20?/-80?. Our default final concentration of glycerol is 50%. Customers could use it as reference.

Uniprot ID: Q96IU4

HGNC Database Link: HGNC

UniGene Database Link: UniGene

KEGG Database Link: KEGG

STRING Database Link: STRING

OMIM Database Link: N/A

View AllClose

0 Reviews

View AllClose