Recombinant Human A disintegrin and metalloproteinase with thrombospondin motifs 4 (ADAMTS4), partial | CSB-EP001311HU1

(No reviews yet) Write a Review
SKU:
CSB-EP001311HU1
Availability:
3 - 7 Working Days
  • Recombinant Human A disintegrin and metalloproteinase with thrombospondin motifs 4 (ADAMTS4), partial
  • (Tris-Glycine gel) Discontinuous SDS-PAGE (reduced) with 5% enrichment gel and 15% separation gel.
£212.80 - £1,152.00

Description

Recombinant Human A disintegrin and metalloproteinase with thrombospondin motifs 4 (ADAMTS4), partial | CSB-EP001311HU1 | Cusabio

Alternative Name(s): ADAM-TS 4;ADAM-TS4;ADAMTS-4;ADMP-1;Aggrecanase-1

Gene Names: ADAMTS4

Research Areas: Cancer

Organism: Homo sapiens (Human)

AA Sequence: FASLSRFVETLVVADDKMAAFHGAGLKRYLLTVMAAAAKAFKHPSIRNPVSLVVTRLVILGSGEEGPQVGPSAAQTLRSFCAWQRGLNTPEDSDPDHFDTAILFTRQ

Source: E.coli

Tag Info: N-terminal GST-tagged

Expression Region: 213-319aa

Sequence Info: Partial

MW: 39.0 kDa

Purity: Greater than 85% as determined by SDS-PAGE.

Relevance: Cleaves aggrecan, a cartilage proteoglycan, and may be involved in its turnover. May play an important role in the destruction of aggrecan in arthritic diseases. Could also be a critical factor in the exacerbation of neurodegeneration in Alzheimer disease. Cleaves aggrecan at the '392-Glu-|-Ala-393' site.

Reference: "Sites of aggrecan cleavage by recombinant human aggrecanase-1 (ADAMTS-4)." Tortorella M.D., Pratta M., Liu R.Q., Austin J., Ross O.H., Abbaszade I., Burn T., Arner E. J Biol Chem 275:18566-18573(2000)

Storage: The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20?/-80?. The shelf life of lyophilized form is 12 months at -20?/-80?.

Notes: Repeated freezing and thawing is not recommended. Store working aliquots at 4? for up to one week.

Function:

Involvement in disease:

Subcellular Location:

Protein Families:

Tissue Specificity:

Paythway:

Form: Liquid or Lyophilized powder

Buffer: If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0.

Reconstitution: We recommend that this vial be briefly centrifuged prior to opening to bring the contents to the bottom. Please reconstitute protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL.We recommend to add 5-50% of glycerol (final concentration) and aliquot for long-term storage at -20?/-80?. Our default final concentration of glycerol is 50%. Customers could use it as reference.

Uniprot ID: O75173

HGNC Database Link: N/A

UniGene Database Link: N/A

KEGG Database Link: N/A

STRING Database Link: N/A

OMIM Database Link: N/A

View AllClose

0 Reviews

View AllClose