Recombinant Human A disintegrin and metalloproteinase with thrombospondin motifs 18 (ADAMTS18), partial | CSB-EP851556HU

Recombinant Human A disintegrin and metalloproteinase with thrombospondin motifs 18 (ADAMTS18), partial | CSB-EP851556HU | Cusabio

Alternative Name(s): ADAMTS21

Gene Names: ADAMTS18

Research Areas: Cell Biology

Organism: Homo sapiens (Human)

AA Sequence: TCSKACAGGQQSRKIQCVQKKPFQKEEAVLHSLCPVSTPTQVQACNSHACPPQWSLGPWSQCSKTCGRGVRKRELLCKGSAAETLPESQCTSLPRPELQEGCVLGR

Source: E.coli

Tag Info: N-terminal 6xHis-tagged

Expression Region: 942-1047aa

Sequence Info: Partial

MW: 15.5 kDa

Purity: Greater than 85% as determined by SDS-PAGE.

Relevance:

Reference: "Quantitative phosphoproteomic analysis of T cell receptor signaling reveals system-wide modulation of protein-protein interactions." Mayya V., Lundgren D.H., Hwang S.-I., Rezaul K., Wu L., Eng J.K., Rodionov V., Han D.K. Sci. Signal. 2:RA46-RA46(2009)

Storage: The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20?/-80?. The shelf life of lyophilized form is 12 months at -20?/-80?.

Notes: Repeated freezing and thawing is not recommended. Store working aliquots at 4? for up to one week.

Function:

Involvement in disease: Microcornea, myopic chorioretinal atrophy, and telecanthus (MMCAT)

Subcellular Location: Secreted, extracellular space, extracellular matrix

Protein Families:

Tissue Specificity: Expressed in fetal lung, liver, and kidney and in adult brain, prostate, submaxillary gland, and endothelium.

Paythway:

Form: Liquid or Lyophilized powder

Buffer: If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0.

Reconstitution: We recommend that this vial be briefly centrifuged prior to opening to bring the contents to the bottom. Please reconstitute protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL.We recommend to add 5-50% of glycerol (final concentration) and aliquot for long-term storage at -20?/-80?. Our default final concentration of glycerol is 50%. Customers could use it as reference.

Uniprot ID: Q8TE60

HGNC Database Link: HGNC

UniGene Database Link: UniGene

KEGG Database Link: KEGG

STRING Database Link: STRING

OMIM Database Link: OMIM