Recombinant Human 7, 8-dihydro-8-oxoguanine triphosphatase (NUDT1) | CSB-BP016154HU

(No reviews yet) Write a Review
SKU:
CSB-BP016154HU
Availability:
3 - 7 Working Days
  • Recombinant Human 7, 8-dihydro-8-oxoguanine triphosphatase (NUDT1)
  • (Tris-Glycine gel) Discontinuous SDS-PAGE (reduced) with 5% enrichment gel and 15% separation gel.
€360.00 - €828.00

Description

Recombinant Human 7, 8-dihydro-8-oxoguanine triphosphatase (NUDT1) | CSB-BP016154HU | Cusabio

Alternative Name(s): 2-hydroxy-dATP diphosphatase (EC:3.6.1.56) 8-oxo-dGTPase Nucleoside diphosphate-linked moiety X motif 1

Gene Names: NUDT1

Research Areas: Others

Organism: Homo sapiens (Human)

AA Sequence: MSGISPQQMGEPEGSWSGKNPGTMGASRLYTLVLVLQPQRVLLGMKKRGFGAGRWNGFGGKVQEGETIEDGARRELQEESGLTVDALHKVGQIVFEFVGEPELMDVHVFCTDSIQGTPVESDEMRPCWFQLDQIPFKDMWPDDSYWFPLLLQKKKFHGYFKFQGQDTILDYTLREVDTV

Source: Baculovirus

Tag Info: N-terminal 10xHis-tagged

Expression Region: 19-197aa

Sequence Info: Full Length of Mature Protein

MW: 22.8 kDa

Purity: Greater than 85% as determined by SDS-PAGE.

Relevance: Antimutagenic. Acts as a sanitizing enzyme for oxidized nucleotide pools, thus suppressing cell dysfunction and death induced by oxidative stress. Hydrolyzes 8-oxo-dGTP, 8-oxo-dATP and 2-OH-dATP, thus preventing misincorporation of oxidized purine nucleoside triphosphates into DNA and subsequently preventing A:T to C:G and G:C to T:A transversions. Able to hydrolyze also the corresponding ribonucleotides, 2-OH-ATP, 8-oxo-GTP and 8-oxo-ATP. Does not play a role in U8 snoRNA decapping activity. Binds U8 snoRNA.

Reference: "Genomic structure and chromosome location of the human mutT homologue gene MTH1 encoding 8-oxo-dGTPase for prevention of A:T to C:G transversion." Furuichi M., Yoshida M.C., Oda H., Tajiri T., Nakabeppu Y., Tsuzuki T., Sekiguchi M. Genomics 24:485-490(1994)

Storage: The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20?/-80?. The shelf life of lyophilized form is 12 months at -20?/-80?.

Notes: Repeated freezing and thawing is not recommended. Store working aliquots at 4? for up to one week.

Function: Antimutagenic. Acts as a sanitizing enzyme for oxidized nucleotide pools, thus suppressing cell dysfunction and death induced by oxidative stress. Hydrolyzes 8-oxo-dGTP, 8-oxo-dATP and 2-OH-dATP, thus preventing misincorporation of oxidized purine nucleoside triphosphates into DNA and subsequently preventing A

Involvement in disease:

Subcellular Location: Isoform p18: Cytoplasm, Mitochondrion matrix, Nucleus

Protein Families: Nudix hydrolase family

Tissue Specificity: Widely expressed with highest expression in thymus, testis, embryo and proliferating blood lymphocytes.

Paythway:

Form: Liquid or Lyophilized powder

Buffer: If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0.

Reconstitution: We recommend that this vial be briefly centrifuged prior to opening to bring the contents to the bottom. Please reconstitute protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL.We recommend to add 5-50% of glycerol (final concentration) and aliquot for long-term storage at -20?/-80?. Our default final concentration of glycerol is 50%. Customers could use it as reference.

Uniprot ID: P36639

HGNC Database Link: HGNC

UniGene Database Link: UniGene

KEGG Database Link: KEGG

STRING Database Link: STRING

OMIM Database Link: OMIM

View AllClose

0 Reviews

View AllClose