Recombinant Human 60S ribosomal protein L36a-like (RPL36AL) | CSB-RP018044h

Recombinant Human 60S ribosomal protein L36a-like (RPL36AL) | CSB-RP018044h | Cusabio

Alternative Name(s): RPL36AL; 60S ribosomal protein L36a-like; Large ribosomal subunit protein eL42-like

Gene Names: RPL36AL

Research Areas: Epigenetics and Nuclear Signaling

Organism: Homo sapiens (Human)

AA Sequence: MVNVPKTRRTFCKKCGKHQPHKVTQYKKGKDSLYAQGRRRYDRKQSGYGGQTKPIFRKKAKTTKKIVLRLECVEPNCRSKRMLAIKRCKHFELGGDKKRKGQVIQF

Source: E.coli

Tag Info: N-terminal GST-tagged

Expression Region: 1-106aa

Sequence Info: Full Length

MW: 39.5 kDa

Purity: Greater than 90% as determined by SDS-PAGE.

Relevance:

Reference: Characterisation of an mRNA encoding a human ribosomal protein homologous to the yeast L44 ribosomal protein.Davies M.S., Henney A., Ward W.H.J., Craig R.K.Gene 45:183-191(1986)

Storage: The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20?/-80?. The shelf life of lyophilized form is 12 months at -20?/-80?.

Notes: Repeated freezing and thawing is not recommended. Store working aliquots at 4? for up to one week.

Function:

Involvement in disease:

Subcellular Location: Cytoplasm

Protein Families: Eukaryotic ribosomal protein eL42 family

Tissue Specificity: Ubiquitously expressed.

Paythway:

Form: Liquid or Lyophilized powder

Buffer: If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0.

Reconstitution: We recommend that this vial be briefly centrifuged prior to opening to bring the contents to the bottom. Please reconstitute protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL.We recommend to add 5-50% of glycerol (final concentration) and aliquot for long-term storage at -20?/-80?. Our default final concentration of glycerol is 50%. Customers could use it as reference.

Uniprot ID: Q969Q0

HGNC Database Link: HGNC

UniGene Database Link: UniGene

KEGG Database Link: KEGG

STRING Database Link: N/A

OMIM Database Link: OMIM