Recombinant Human 6-phosphogluconate dehydrogenase, decarboxylating (PGD), partial | CSB-RP011554h

(No reviews yet) Write a Review
SKU:
CSB-RP011554h
Availability:
13 - 23 Working Days
  • Recombinant Human 6-phosphogluconate dehydrogenase, decarboxylating (PGD), partial
  • (Tris-Glycine gel) Discontinuous SDS-PAGE (reduced) with 5% enrichment gel and 15% separation gel.
$294.00 - $1,532.40

Description

Recombinant Human 6-phosphogluconate dehydrogenase, decarboxylating (PGD), partial | CSB-RP011554h | Cusabio

Alternative Name(s): 0610042A05Rik; 6 phosphogluconate dehydrogenase; decarboxylating; 6-phosphogluconate dehydrogenase; 6PGD; 6PGD_HUMAN; AU019875; C78335; decarboxylating; OTTMUSP00000011754; Pgd; Phosphogluconate dehydrogenase; RP23-249G3.4

Gene Names: PGD

Research Areas: Metabolism

Organism: Homo sapiens (Human)

AA Sequence: ADIALIGLAVMGQNLILNMNDHGFVVCAFNRTVSKVDDFLANEAKGTKVVGAQSLKEMVSKLKKPRRIILLVKAGQAVDDFIEKLVPLLDTGDIIIDGGNSEYRDTTRRCRDLKAKGILFVGSGVSGGEEGARYGPSLMPGGNKEAWPHIKTIFQGIAAKVGTGEPCCDWVGDEGAGHFVKMVHNGIEYGDMQLICEAYHLMKDVLGMAQDEMAQAFEDWNKTELDSFLIEITANILKFQDTDGKHLLPKIRDSAGQKGTGKWTAISALEYGVPVTLIGEAVFARCLSSLKDERIQASKKLKGPQKFQFDGDKKSFLEDIRKALYASKIISYAQGFMLLRQAATEFGWTLNYGGIALMWRGGCIIRSVFLGKIKDAFDRNPELQNLLLDDFFKSAVENCQDSWRRAVSTGVQAGIPMPCFTTALSFYDGYRHEMLPASLIQAQRDYFGAHTYELLAKPGQFIHTNWTGHGGTVSSSSYNA

Source: E.coli

Tag Info: N-terminal GST-tagged

Expression Region: 4-483aa

Sequence Info: Partial

MW: 79.8 kDa

Purity: Greater than 90% as determined by SDS-PAGE.

Relevance: Catalyzes the oxidative decarboxylation of 6-phosphogluconate to ribulose 5-phosphate and CO2, with concomitant reduction of NADP to NADPH.

Reference: Identification of a cDNA encoding 6-phosphogluconate dehydrogenase from a human heart cDNA library.Tsui S.K.W., Chan J.Y., Waye M.M.Y., Fung K.-P., Lee C.-Y.Biochem. Genet. 34:367-373(1996)

Storage: The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20?/-80?. The shelf life of lyophilized form is 12 months at -20?/-80?.

Notes: Repeated freezing and thawing is not recommended. Store working aliquots at 4? for up to one week.

Function: Catalyzes the oxidative decarboxylation of 6-phosphogluconate to ribulose 5-phosphate and CO(2), with concomitant reduction of NADP to NADPH.

Involvement in disease:

Subcellular Location: Cytoplasm

Protein Families: 6-phosphogluconate dehydrogenase family

Tissue Specificity:

Paythway:

Form: Liquid or Lyophilized powder

Buffer: If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0.

Reconstitution: We recommend that this vial be briefly centrifuged prior to opening to bring the contents to the bottom. Please reconstitute protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL.We recommend to add 5-50% of glycerol (final concentration) and aliquot for long-term storage at -20?/-80?. Our default final concentration of glycerol is 50%. Customers could use it as reference.

Uniprot ID: P52209

HGNC Database Link: HGNC

UniGene Database Link: UniGene

KEGG Database Link: KEGG

STRING Database Link: STRING

OMIM Database Link: OMIM

View AllClose

0 Reviews

View AllClose