Recombinant Human 5-hydroxytryptamine receptor 1D (HTR1D), partial | CSB-EP010883HU2

(No reviews yet) Write a Review
SKU:
CSB-EP010883HU2
Availability:
3 - 7 Working Days
$422.40 - $2,042.40

Description

Recombinant Human 5-hydroxytryptamine receptor 1D (HTR1D), partial | CSB-EP010883HU2 | Cusabio

Alternative Name(s): 5-hydroxytryptamine receptor 1D(5-HT-1D)(5-HT1D)(Serotonin 1D alpha receptor)(5-HT-1D-alpha)(Serotonin receptor 1D)

Gene Names: HTR1D

Research Areas: Others

Organism: Homo sapiens (Human)

AA Sequence: MSPLNQSAEGLPQEASNRSLNATETSEAWDPRTLQALK

Source: E.coli

Tag Info: N-terminal 6xHis-KSI-tagged

Expression Region: 1-38aa

Sequence Info: Partial

MW: 19.5 kDa

Purity: Greater than 85% as determined by SDS-PAGE.

Relevance: G-protein coupled receptor for 5-hydroxytryptamine (serotonin). Also functions as a receptor for ergot alkaloid derivatives, various anxiolytic and antidepressant drugs and other psychoactive substances. Ligand binding causes a conformation change that triggers signaling via guanine nucleotide-binding proteins (G proteins) and modulates the activity of down-stream effectors, such as adenylate cyclase. Signaling inhibits adenylate cyclase activity. Regulates the release of 5-hydroxytryptamine in the brain, and thereby affects neural activity. May also play a role in regulating the release of other neurotransmitters. May play a role in vasoconstriction.

Reference: "Serotonin 5-HT1B and 5-HT1D receptors form homodimers when expressed alone and heterodimers when co-expressed." Xie Z., Lee S.P., O'Dowd B.F., George S.R. FEBS Lett. 456:63-67(1999)

Storage: The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20?/-80?. The shelf life of lyophilized form is 12 months at -20?/-80?.

Notes: Repeated freezing and thawing is not recommended. Store working aliquots at 4? for up to one week.

Function:

Involvement in disease:

Subcellular Location:

Protein Families:

Tissue Specificity:

Paythway:

Form: Liquid or Lyophilized powder

Buffer: If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0.

Reconstitution: We recommend that this vial be briefly centrifuged prior to opening to bring the contents to the bottom. Please reconstitute protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL.We recommend to add 5-50% of glycerol (final concentration) and aliquot for long-term storage at -20?/-80?. Our default final concentration of glycerol is 50%. Customers could use it as reference.

Uniprot ID: P28221

HGNC Database Link: N/A

UniGene Database Link: N/A

KEGG Database Link: N/A

STRING Database Link: N/A

OMIM Database Link: N/A

View AllClose

0 Reviews

View AllClose