Cusabio Human Recombinants
Recombinant Human 40S ribosomal protein S27 (RPS27) | CSB-EP020419HU
- SKU:
- CSB-EP020419HU
- Availability:
- 13 - 23 Working Days
Description
Recombinant Human 40S ribosomal protein S27 (RPS27) | CSB-EP020419HU | Cusabio
Alternative Name(s): Metallopan-stimulin 1
Gene Names: RPS27
Research Areas: Others
Organism: Homo sapiens (Human)
AA Sequence: PLAKDLLHPSPEEEKRKHKKKRLVQSPNSYFMDVKCPGCYKITTVFSHAQTVVLCVGCSTVLCQPTGGKARLTEGCSFRRKQH
Source: E.coli
Tag Info: N-terminal GST-tagged
Expression Region: 1-84aa
Sequence Info: Full Length
MW: 36.3 kDa
Purity: Greater than 90% as determined by SDS-PAGE.
Relevance:
Reference: "A growth factor-inducible gene encodes a novel nuclear protein with zinc finger structure." Fernandez-Pol J.A., Klos D.J., Hamilton P.D. J. Biol. Chem. 268:21198-21204(1993)
Storage: The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20?/-80?. The shelf life of lyophilized form is 12 months at -20?/-80?.
Notes: Repeated freezing and thawing is not recommended. Store working aliquots at 4? for up to one week.
Function: Component of the small ribosomal subunit
Involvement in disease: Diamond-Blackfan anemia 17 (DBA17)
Subcellular Location:
Protein Families: Eukaryotic ribosomal protein eS27 family
Tissue Specificity: Expressed in a wide variety of actively proliferating cells and tumor tissues.
Paythway:
Form: Liquid or Lyophilized powder
Buffer: If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0.
Reconstitution: We recommend that this vial be briefly centrifuged prior to opening to bring the contents to the bottom. Please reconstitute protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL.We recommend to add 5-50% of glycerol (final concentration) and aliquot for long-term storage at -20?/-80?. Our default final concentration of glycerol is 50%. Customers could use it as reference.
Uniprot ID: P42677
HGNC Database Link: HGNC
UniGene Database Link: UniGene
KEGG Database Link: KEGG
STRING Database Link: STRING
OMIM Database Link: OMIM