Cusabio Human Recombinants
Recombinant Human 39S ribosomal protein L42, mitochondrial (MRPL42) | CSB-EP014852HU
- SKU:
- CSB-EP014852HU
- Availability:
- 13 - 23 Working Days
Description
Recombinant Human 39S ribosomal protein L42, mitochondrial (MRPL42) | CSB-EP014852HU | Cusabio
Alternative Name(s): 28S ribosomal protein S32, mitochondrial ;MRP-S32 ;S32mt39S ribosomal protein L31, mitochondrial ;L31mt ;MRP-L31
Gene Names: MRPL42
Research Areas: Epigenetics and Nuclear Signaling
Organism: Homo sapiens (Human)
AA Sequence: KSTYSPLPDDYNCNVELALTSDGRTIVCYHPSVDIPYEHTKPIPRPDPVHNNEETHDQVLKTRLEEKVEHLEEGPMIEQLSKMFFTTKHRWYPHGRYHRCRKNLNPPKDR
Source: E.coli
Tag Info: N-terminal GST-tagged
Expression Region: 33-142aa
Sequence Info: Full Length of Mature Protein
MW: 40.1 kDa
Purity: Greater than 90% as determined by SDS-PAGE.
Relevance:
Reference: Mao Y.F., Peng Y., Dai M., Huang Q.H., Song H., Zhang Q.H., Mao M., Fu G., Luo M., Chen J.H., Hu R. Isolating a new human cDNA.Chen J.H., Luo W.Q., Hu S.N., Li G.T., Jin J., Huang X.W., Zhou H.J., Yuan J.G., Qiang B.Q.Cloning and functional analysis of cDNAs with open reading frames for 300 previously undefined genes expressed in CD34+ hematopoietic stem/progenitor cells.Zhang Q.-H., Ye M., Wu X.-Y., Ren S.-X., Zhao M., Zhao C.-J., Fu G., Shen Y., Fan H.-Y., Lu G., Zhong M., Xu X.-R., Han Z.-G., Zhang J.-W., Tao J., Huang Q.-H., Zhou J., Hu G.-X. , Gu J., Chen S.-J., Chen Z.Genome Res. 10:1546-1560(2000)
Storage: The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20?/-80?. The shelf life of lyophilized form is 12 months at -20?/-80?.
Notes: Repeated freezing and thawing is not recommended. Store working aliquots at 4? for up to one week.
Function:
Involvement in disease:
Subcellular Location: Mitochondrion
Protein Families: Mitochondrion-specific ribosomal protein mL42 family
Tissue Specificity:
Paythway:
Form: Liquid or Lyophilized powder
Buffer: If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0.
Reconstitution: We recommend that this vial be briefly centrifuged prior to opening to bring the contents to the bottom. Please reconstitute protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL.We recommend to add 5-50% of glycerol (final concentration) and aliquot for long-term storage at -20?/-80?. Our default final concentration of glycerol is 50%. Customers could use it as reference.
Uniprot ID: Q9Y6G3
HGNC Database Link: HGNC
UniGene Database Link: UniGene
KEGG Database Link: KEGG
STRING Database Link: STRING
OMIM Database Link: OMIM