Recombinant Human 14KDA phosphohistidine phosphatase (PHPT1) | CSB-YP017942HU

(No reviews yet) Write a Review
SKU:
CSB-YP017942HU
Availability:
3 - 7 Working Days
  • Recombinant Human 14KDA phosphohistidine phosphatase (PHPT1)
  • (Tris-Glycine gel) Discontinuous SDS-PAGE (reduced) with 5% enrichment gel and 15% separation gel.
$314.40 - $486.00

Description

Recombinant Human 14KDA phosphohistidine phosphatase (PHPT1) | CSB-YP017942HU | Cusabio

Alternative Name(s): Phosphohistidine phosphatase 1;Protein janus-A homolog

Gene Names: PHPT1

Research Areas: Cell Biology

Organism: Homo sapiens (Human)

AA Sequence: MAVADLALIPDVDIDSDGVFKYVLIRVHSAPRSGAPAAESKEIVRGYKWAEYHADIYDKVSGDMQKQGCDCECLGGGRISHQSQDKKIHVYGYSMAYGPAQHAISTEKIKAKYPDYEVTWANDGY

Source: Yeast

Tag Info: N-terminal 6xHis-tagged

Expression Region: 1-125aa

Sequence Info: Full Length

MW: 15.8 kDa

Purity: Greater than 90% as determined by SDS-PAGE.

Relevance: Exhibits phosphohistidine phosphatase activity.

Reference: Identification and characterization of a mammalian 14-KDA phosphohistidine phosphatase.Ek P., Pettersson G., Ek B., Gong F., Li J.-P., Zetterqvist O.Eur. J. Biochem. 269:5016-5023(2002)

Storage: The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20?/-80?. The shelf life of lyophilized form is 12 months at -20?/-80?.

Notes: Repeated freezing and thawing is not recommended. Store working aliquots at 4? for up to one week.

Function: Exhibits phosphohistidine phosphatase activity.

Involvement in disease:

Subcellular Location: Cytoplasm

Protein Families: Janus family

Tissue Specificity: Expressed abundantly in heart and skeletal muscle.

Paythway:

Form: Liquid or Lyophilized powder

Buffer: If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0.

Reconstitution: We recommend that this vial be briefly centrifuged prior to opening to bring the contents to the bottom. Please reconstitute protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL.We recommend to add 5-50% of glycerol (final concentration) and aliquot for long-term storage at -20?/-80?. Our default final concentration of glycerol is 50%. Customers could use it as reference.

Uniprot ID: Q9NRX4

HGNC Database Link: HGNC

UniGene Database Link: UniGene

KEGG Database Link: KEGG

STRING Database Link: STRING

OMIM Database Link: OMIM

View AllClose

0 Reviews

View AllClose