Recombinant Human 14-3-3 protein zeta/delta (YWHAZ), partial | CSB-EP026293HU1

Recombinant Human 14-3-3 protein zeta/delta (YWHAZ), partial | CSB-EP026293HU1 | Cusabio

Alternative Name(s): Protein kinase C inhibitor protein 1 (KCIP-1)

Gene Names: YWHAZ

Research Areas: Cell Biology

Organism: Homo sapiens (Human)

AA Sequence: AAGDDKKGIVDQSQQAYQEAFEISKKEMQPTHPIRLGLALNFSVFYYEILNSPEKACSLAKTAFDEAIAELDTLSEESYK

Source: E.coli

Tag Info: N-terminal 6xHis-GST-tagged

Expression Region: 133-212aa

Sequence Info: Partial

MW: 40.6 kDa

Purity: Greater than 85% as determined by SDS-PAGE.

Relevance: Adapter protein implicated in the regulation of a large spectrum of both general and specialized signaling pathways. Binds to a large number of partners, usually by recognition of a phosphoserine or phosphothreonine motif. Binding generally results in the modulation of the activity of the binding partner.

Reference: "ACBD3 interaction with TBC1 domain 22 protein is differentially affected by enteroviral and kobuviral 3A protein binding." Greninger A.L., Knudsen G.M., Betegon M., Burlingame A.L., DeRisi J.L. MBio 4:E00098-E00098(2013)

Storage: The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20?/-80?. The shelf life of lyophilized form is 12 months at -20?/-80?.

Notes: Repeated freezing and thawing is not recommended. Store working aliquots at 4? for up to one week.

Function:

Involvement in disease:

Subcellular Location:

Protein Families:

Tissue Specificity:

Paythway:

Form: Liquid or Lyophilized powder

Buffer: If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0.

Reconstitution: We recommend that this vial be briefly centrifuged prior to opening to bring the contents to the bottom. Please reconstitute protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL.We recommend to add 5-50% of glycerol (final concentration) and aliquot for long-term storage at -20?/-80?. Our default final concentration of glycerol is 50%. Customers could use it as reference.

Uniprot ID: P63104

HGNC Database Link: N/A

UniGene Database Link: N/A

KEGG Database Link: N/A

STRING Database Link: N/A

OMIM Database Link: N/A