Recombinant Hottentotta judaicus Alpha-insect toxin BjaIT | CSB-EP690933BOA

(No reviews yet) Write a Review
SKU:
CSB-EP690933BOA
Availability:
3 - 7 Working Days
£281.60 - £1,361.60

Description

Recombinant Hottentotta judaicus Alpha-insect toxin BjaIT | CSB-EP690933BOA | Cusabio

Alternative Name(s): Bj-alpha-IT

Gene Names: N/A

Research Areas: Others

Organism: Hottentotta judaicus(Black scorpion)(Buthotus judaicus)

AA Sequence: GRDAYIADNLNCAYTCGSNSYCNTECTKNGAVSGYCQWLGKYGNACWCINLPDKVPIRIPGACR

Source: E.coli

Tag Info: N-terminal 10xHis-tagged and C-terminal Myc-tagged

Expression Region: 20-83aa

Sequence Info: Full Length of Mature Protein

MW: 14.4 kDa

Purity: Greater than 85% as determined by SDS-PAGE.

Relevance: Alpha toxins bind voltage-independently at site-3 of sodium channels and inhibit the inactivation of the activated channels, thereby blocking neuronal transmission. This toxin is active against insects.

Reference: "BjalphaIT: a novel scorpion alpha-toxin selective for insects -- unique pharmacological tool." Arnon T., Potikha T., Sher D., Elazar M., Mao W., Tal T., Bosmans F., Tytgat J., Ben-Arie N., Zlotkin E. Insect Biochem. Mol. Biol. 35:187-195(2005)

Storage: The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20?/-80?. The shelf life of lyophilized form is 12 months at -20?/-80?.

Notes: Repeated freezing and thawing is not recommended. Store working aliquots at 4? for up to one week.

Function:

Involvement in disease:

Subcellular Location:

Protein Families:

Tissue Specificity:

Paythway:

Form: Liquid or Lyophilized powder

Buffer: If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0.

Reconstitution: We recommend that this vial be briefly centrifuged prior to opening to bring the contents to the bottom. Please reconstitute protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL.We recommend to add 5-50% of glycerol (final concentration) and aliquot for long-term storage at -20?/-80?. Our default final concentration of glycerol is 50%. Customers could use it as reference.

Uniprot ID: Q56TT9

HGNC Database Link: N/A

UniGene Database Link: N/A

KEGG Database Link: N/A

STRING Database Link: N/A

OMIM Database Link: N/A

View AllClose

0 Reviews

View AllClose