Recombinant Hepatitis E virus genotype 1 Protein ORF3 (ORF3) | CSB-EP527126HVZ

Recombinant Hepatitis E virus genotype 1 Protein ORF3 (ORF3) | CSB-EP527126HVZ | Cusabio

Alternative Name(s): ORF3; Protein ORF3; pORF3

Gene Names: ORF3

Research Areas: Others

Organism: Hepatitis E virus genotype 1 (isolate Human/Pakistan/Sar-55) (HEV-1)

AA Sequence: MGSRPWALGLFCCCSSCFCLCCSRHRPVSRLAAVVGGAAAVPAVVSGVTGLILSPSQSPIFIQPTPSPRMSPLRPGLDLVFANPSDHSAPLGATRPSAPPLPHVVDLPQLGPRR

Source: E.coli

Tag Info: N-terminal 6xHis-SUMO-tagged

Expression Region: 1-114aa

Sequence Info: Full Length

MW: 27.8 kDa

Purity: Greater than 90% as determined by SDS-PAGE.

Relevance: May act as a viral regulatory protein involved in the modulation of mitogenic signaling pathways. May be involved in virion morphogenesis and viral pathogenesis. Expedites the processing and secretion of AMBP from the hepatocyte.

Reference: The ORF3 protein of hepatitis E virus interacts with hemopexin by means of its 26 amino acid N-terminal hydrophobic domain II.Ratra R., Kar-Roy A., Lal S.K.Biochemistry 47:1957-1969(2008)

Storage: The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20?/-80?. The shelf life of lyophilized form is 12 months at -20?/-80?.

Notes: Repeated freezing and thawing is not recommended. Store working aliquots at 4? for up to one week.

Function: May act as a viral regulatory protein involved in the modulation of mitogenic signaling pathways. May be involved in virion morphogenesis and viral pathogenesis. Expedites the processing and secretion of AMBP from the hepatocyte.

Involvement in disease:

Subcellular Location: Host cytoplasm, host cytoskeleton

Protein Families: Hepevirus ORF3 protein family

Tissue Specificity:

Paythway:

Form: Liquid or Lyophilized powder

Buffer: If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0.

Reconstitution: We recommend that this vial be briefly centrifuged prior to opening to bring the contents to the bottom. Please reconstitute protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL.We recommend to add 5-50% of glycerol (final concentration) and aliquot for long-term storage at -20?/-80?. Our default final concentration of glycerol is 50%. Customers could use it as reference.

Uniprot ID: O90299

HGNC Database Link: N/A

UniGene Database Link: N/A

KEGG Database Link: N/A

STRING Database Link: N/A

OMIM Database Link: N/A