Recombinant Helicobacter pylori Vacuolating cytotoxin autotransporter (vacA), partial | CSB-RP143774Ba(N)

(No reviews yet) Write a Review
SKU:
CSB-RP143774Ba(N)
Availability:
3 - 7 Working Days
  • Recombinant Helicobacter pylori Vacuolating cytotoxin autotransporter (vacA), partial
  • (Tris-Glycine gel) Discontinuous SDS-PAGE (reduced) with 5% enrichment gel and 15% separation gel.
£281.60 - £1,361.60

Description

Recombinant Helicobacter pylori Vacuolating cytotoxin autotransporter (vacA), partial | CSB-RP143774Ba(N) | Cusabio

Alternative Name(s): vacA; HP_0887; Vacuolating cytotoxin autotransporter [Cleaved into: Vacuolating cytotoxin; Vacuolating cytotoxin translocator]

Gene Names: vacA

Research Areas: Others

Organism: Helicobacter pylori (strain ATCC 700392 / 26695) (Campylobacter pylori)

AA Sequence: TTVIIPAIVGGIATGAAVGTVSGLLGWGLKQAEEANKTPDKPDKVWRIQAGKGFNEFPNKEYDLYRSLLSSKIDGGWDWGNAATHYWVKGGQWNKLEVDMKDAVGTYNLSGLRNFTGGDLDVNMQKATLRLGQFNGNSFTSYKDSADRTTRVDFNAKNILIDNFLEINNRVGSGAGRKASSTVLTLQASEGITSSKNAEISLYDGATLN

Source: E.coli

Tag Info: N-terminal 6xHis-tagged

Expression Region: 37-245aa

Sequence Info: Partial

MW: 26.6 kDa

Purity: Greater than 90% as determined by SDS-PAGE.

Relevance: Induces vacuolation of eukaryotic cells. Causes ulceration and gastric lesions.

Reference: The complete genome sequence of the gastric pathogen Helicobacter pylori.Tomb J.-F., White O., Kerlavage A.R., Clayton R.A., Sutton G.G., Fleischmann R.D., Ketchum K.A., Klenk H.-P., Gill S.R., Dougherty B.A., Nelson K.E., Quackenbush J., Zhou L., Kirkness E.F., Peterson S.N., Loftus B.J., Richardson D.L., Dodson R.J. , Khalak H.G., Glodek A., McKenney K., FitzGerald L.M., Lee N., Adams M.D., Hickey E.K., Berg D.E., Gocayne J.D., Utterback T.R., Peterson J.D., Kelley J.M., Cotton M.D., Weidman J.F., Fujii C., Bowman C., Watthey L., Wallin E., Hayes W.S., Borodovsky M., Karp P.D., Smith H.O., Fraser C.M., Venter J.C.Nature 388:539-547(1997)

Storage: The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20?/-80?. The shelf life of lyophilized form is 12 months at -20?/-80?.

Notes: Repeated freezing and thawing is not recommended. Store working aliquots at 4? for up to one week.

Function: Induces vacuolation of eukaryotic cells. Causes ulceration and gastric lesions.

Involvement in disease:

Subcellular Location: Vacuolating cytotoxin autotransporter: Periplasm, SUBCELLULAR LOCATION: Vacuolating cytotoxin: Secreted, Cell surface, SUBCELLULAR LOCATION: Vacuolating cytotoxin translocator: Cell outer membrane, Multi-pass membrane protein

Protein Families:

Tissue Specificity:

Paythway:

Form: Liquid or Lyophilized powder

Buffer: If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0.

Reconstitution: We recommend that this vial be briefly centrifuged prior to opening to bring the contents to the bottom. Please reconstitute protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL.We recommend to add 5-50% of glycerol (final concentration) and aliquot for long-term storage at -20?/-80?. Our default final concentration of glycerol is 50%. Customers could use it as reference.

Uniprot ID: P55981

HGNC Database Link: N/A

UniGene Database Link: N/A

KEGG Database Link: KEGG

STRING Database Link: STRING

OMIM Database Link: N/A

View AllClose

0 Reviews

View AllClose