Recombinant Helicobacter pylori Putative peptidyl-prolyl cis-trans isomerase HP_0175 (HP-0175) (Active) | CSB-EP345551HUV

(No reviews yet) Write a Review
SKU:
CSB-EP345551HUV
Availability:
3 to 7 Working Days
  • Recombinant Helicobacter pylori Putative peptidyl-prolyl cis-trans isomerase HP_0175 (HP-0175) (Active)
  • Recombinant Helicobacter pylori Putative peptidyl-prolyl cis-trans isomerase HP_0175 (HP-0175) (Active) Activity
  • (Tris-Glycine gel) Discontinuous SDS-PAGE (reduced) with 5% enrichment gel and 15% separation gel.
£212.80 - £1,152.00

Description

Recombinant Helicobacter pylori Putative peptidyl-prolyl cis-trans isomerase HP_0175 (HP-0175) (Active) | CSB-EP345551HUV | Cusabio

Protein Description: Full Length

Alternative Name (s) : Rotamase HP_0175

Gene Names: HP-0175

Research Areas: Others

Species: Helicobacter pylori (strain ATCC 700392 / 26695) (Campylobacter pylori)

Source: E.coli

Tag Info: N-terminal GST-tagged

Expression Region: 22-299aa

Sequence Info: KPAHNANNATHNTKKTTDSSAGVLATVDGRPITKSDFDMIKQRNPNFDFDKLKEKEKEALIDQAIRTALVENEAKTEKLDSTPEFKAMMEAVKKQALVEFWAKKQAEEVKKVQIPEKEMQDFYNANKDQLFVKQEAHARHILVKTEDEAKRIISEIDKQPKAKKEAKFIELANRDTIDPNSKNAQNGGDLGKFQKNQMAPDFSKAAFALTPGDYTKTPVKTEFGYHIIYLISKDSPVTYTYEQAKPTIKGMLQEKLFQERMNQRIEELRKHAKIVINK

Biological Activity: Measured by its binding ability in a functional ELISA. Immobilized yuaB at 5 μg/ml can bind human HP_0175 with a linear range of 31.25-600.00 ng/ml.

MW: 58.8 kDa

Purity: Greater than 90% as determined by SDS-PAGE.

Endotoxin: Not test.

Relevance:

PubMed ID:

Notes: Repeated freezing and thawing is not recommended. Store working aliquots at 4℃ for up to one week.

Function:

Involvement in disease:

Subcellular Location:

Protein Families:

Tissue Specificity:

Paythway:

Form: Liquid or Lyophilized powder

Buffer: If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0.

Reconstitution: We recommend that this vial be briefly centrifuged prior to opening to bring the contents to the bottom. Please reconstitute protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL.We recommend to add 5-50% of glycerol (final concentration) and aliquot for long-term storage at -20℃/-80℃. Our default final concentration of glycerol is 50%. Customers could use it as reference.

Uniprot ID: P56112

Uniprot Entry Name:

HGNC Database Link: N/A

UniGene Database Link: N/A

KEGG Database Link: N/A

STRING Database Link: N/A

OMIM Database Link: N/A

View AllClose

0 Reviews

View AllClose