Recombinant Helicobacter pylori DNA protection during starvation protein (dps) | CSB-EP337381HUV

(No reviews yet) Write a Review
SKU:
CSB-EP337381HUV
Availability:
3 - 7 Working Days
  • Recombinant Helicobacter pylori DNA protection during starvation protein (dps)
  • (Tris-Glycine gel) Discontinuous SDS-PAGE (reduced) with 5% enrichment gel and 15% separation gel.
$422.40 - $2,042.40

Description

Recombinant Helicobacter pylori DNA protection during starvation protein (dps) | CSB-EP337381HUV | Cusabio

Alternative Name(s): Bacterioferritin HP-NAP Neutrophil-activating protein A Short name:NAP A

Gene Names: dps

Research Areas: Microbiology

Organism: Helicobacter pylori (strain ATCC 700392 / 26695) (Campylobacter pylori)

AA Sequence: MKTFEILKHLQADAIVLFMKVHNFHWNVKGTDFFNVHKATEEIYEEFADMFDDLAERIVQLGHHPLVTLSEAIKLTRVKEETKTSFHSKDIFKEILEDYKYLEKEFKELSNTAEKEGDKVTVTYADDQLAKLQKSIWMLQAHLA

Source: E.coli

Tag Info: N-terminal 6xHis-SUMO-tagged

Expression Region: 1-144aa

Sequence Info: Full Length

MW: 32.9 kDa

Purity: Greater than 90% as determined by SDS-PAGE.

Relevance: Protects DNA from oxidative damage by sequestering intracellular Fe2+ ion and storing it in the form of Fe3+ oxyhydroxide mineral. One hydrogen peroxide oxidizes two Fe2+ ions, which prevents hydroxyl radical production by the Fenton reaction (By similarity). Required for the survival in the presence of oxidative stress. Dps is also a virulence factor that activates neutrophils, mast cells and monocytes. It binds to neutrophil-glycosphingolipids and to sulfated carbohydrates on mucin. It might have a role in the accumulation of neutrophils and monocytes at the site of infection. Induces superoxide anion generation, adhesion and chemotaxis of neutrophils, through a pertussis toxin-sensitive pathway involving MAP kinases.

Reference: "Identification of four new prokaryotic bacterioferritins, from Helicobacter pylori, Anabaena variabilis, Bacillus subtilis and Treponema pallidum, by analysis of gene sequences."Evans D.J. Jr., Evans D.G., Lampert H.C., Nakano H.Gene 153:123-127(1995)

Storage: The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20?/-80?. The shelf life of lyophilized form is 12 months at -20?/-80?.

Notes: Repeated freezing and thawing is not recommended. Store working aliquots at 4? for up to one week.

Function: Protects DNA from oxidative damage by sequestering intracellular Fe(2+) ion and storing it in the form of Fe(3+) oxyhydroxide mineral. One hydrogen peroxide oxidizes two Fe(2+) ions, which prevents hydroxyl radical production by the Fenton reaction (By similarity). Required for the survival in the presence of oxidative stress. Dps is also a virulence factor that activates neutrophils, mast cells and monocytes. It binds to neutrophil-glycosphingolipids and to sulfated carbohydrates on mucin. It might have a role in the accumulation of neutrophils and monocytes at the site of infection. Induces superoxide anion generation, adhesion and chemotaxis of neutrophils, through a pertussis toxin-sensitive pathway involving MAP kinases.

Involvement in disease:

Subcellular Location: Cytoplasm

Protein Families: Dps family

Tissue Specificity:

Paythway:

Form: Liquid or Lyophilized powder

Buffer: If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0.

Reconstitution: We recommend that this vial be briefly centrifuged prior to opening to bring the contents to the bottom. Please reconstitute protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL.We recommend to add 5-50% of glycerol (final concentration) and aliquot for long-term storage at -20?/-80?. Our default final concentration of glycerol is 50%. Customers could use it as reference.

Uniprot ID: P43313

HGNC Database Link: N/A

UniGene Database Link: N/A

KEGG Database Link: KEGG

STRING Database Link: STRING

OMIM Database Link: N/A

View AllClose

0 Reviews

View AllClose