Recombinant Halobacterium salinarum Cobalamin import ATP-binding protein BtuD (btuD) | CSB-EP538512HTLb0

Recombinant Halobacterium salinarum Cobalamin import ATP-binding protein BtuD (btuD) | CSB-EP538512HTLb0 | Cusabio

Alternative Name(s): Vitamin B12-transporting ATPase

Gene Names: btuD

Research Areas: Others

Organism: Halobacterium salinarum (strain ATCC 29341 / DSM 671 / R1)

AA Sequence: MTLDVTGLDVELAGTRILDDVHASIRDGHLVGVVGPNGAGKSTLLRAMNGLITPTAGTVLVAGDDVHALSSAAASRRIATVPQDASVSFEFTVRQVVEMGRHPHTTRFGTDTDTAVVDRAMARTGVAQFAARDVTSLSGGERQRVLLARALAQAAPVLLLDEPTASLDVNHQIRTLEVVRDLADSEDRAVVAAIHDLDLAARYCDELVVVADGRVHDAGAPRSVLTPDTIRAAFDARVAVGTDPATGAVTVTPLPDRTSAAADTSVHVVGGGDSATPVVRRLVSAGASVSVGPVVEGDTDHETARRVGCPCTSVAPFTRLEDTTAASATRADIAAADVIAVPVAAAARPGVRGLLTGAVPTLAVGDAAGAPEWADRLVACDAVVSAVGALADTPSDGV

Source: E.coli

Tag Info: N-terminal 10xHis-tagged

Expression Region: 1-398aa

Sequence Info: Full Length

MW: 44.9 kDa

Purity: Greater than 85% as determined by SDS-PAGE.

Relevance: Required for corrinoid utilization. Probably part of the ABC transporter complex BtuCDF involved in cobalamin import. Probably responsible for energy coupling to the transport system.

Reference: "Evolution in the laboratory: the genome of Halobacterium salinarum strain R1 compared to that of strain NRC-1." Pfeiffer F., Schuster S.C., Broicher A., Falb M., Palm P., Rodewald K., Ruepp A., Soppa J., Tittor J., Oesterhelt D. Genomics 91:335-346(2008)

Storage: The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20?/-80?. The shelf life of lyophilized form is 12 months at -20?/-80?.

Notes: Repeated freezing and thawing is not recommended. Store working aliquots at 4? for up to one week.

Function: Required for corrinoid utilization. Probably part of the ABC transporter complex BtuCDF involved in cobalamin (vitamin B12) import. Probably responsible for energy coupling to the transport system (By similarity).

Involvement in disease:

Subcellular Location: Cell membrane, Peripheral membrane protein

Protein Families: ABC transporter superfamily

Tissue Specificity:

Paythway:

Form: Liquid or Lyophilized powder

Buffer: If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0.

Reconstitution: We recommend that this vial be briefly centrifuged prior to opening to bring the contents to the bottom. Please reconstitute protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL.We recommend to add 5-50% of glycerol (final concentration) and aliquot for long-term storage at -20?/-80?. Our default final concentration of glycerol is 50%. Customers could use it as reference.

Uniprot ID: B0R5G4

HGNC Database Link: N/A

UniGene Database Link: N/A

KEGG Database Link: KEGG

STRING Database Link: N/A

OMIM Database Link: N/A