Recombinant Haliotis laevigata Perlwapin | CSB-YP306283HAZ

Recombinant Haliotis laevigata Perlwapin | CSB-YP306283HAZ | Cusabio

Alternative Name(s): ; Perlwapin

Gene Names: N/A

Research Areas: Others

Organism: Haliotis laevigata (Smooth Australian abalone)

AA Sequence: YGPNLPGCPPGPYPRICARYCHSDRECKAGYYCCNTGCLNICVPKPKPGLCPAIRPGPCKGNVCSNDQDCPGNQKCCGKPGCRRCYRPEKPGSCPPRKYDAGVCVIYCVGDFDCPGNEKCCGSCPRRCEKPCFD

Source: Yeast

Tag Info: N-terminal 6xHis-tagged

Expression Region: 1-134aa

Sequence Info: Full Length

MW: 16.5 kDa

Purity: Greater than 90% as determined by SDS-PAGE.

Relevance: Inhibits growth of calcium carbonate crystals. May inhibit growth of certain crystallographic planes in the mineral phase of nacre in the shell.

Reference: "Perlwapin, an abalone nacre protein with three four-disulfide core (whey acidic protein) domains, inhibits the growth of calcium carbonate crystals."Treccani L., Mann K., Heinemann F., Fritz M.Biophys. J. 91:2601-2608(2006)

Storage: The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20?/-80?. The shelf life of lyophilized form is 12 months at -20?/-80?.

Notes: Repeated freezing and thawing is not recommended. Store working aliquots at 4? for up to one week.

Function: Inhibits growth of calcium carbonate crystals. May inhibit growth of certain crystallographic planes in the mineral phase of nacre in the shell.

Involvement in disease:

Subcellular Location:

Protein Families:

Tissue Specificity: Nacreous layer of shell.

Paythway:

Form: Liquid or Lyophilized powder

Buffer: If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0.

Reconstitution: We recommend that this vial be briefly centrifuged prior to opening to bring the contents to the bottom. Please reconstitute protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL.We recommend to add 5-50% of glycerol (final concentration) and aliquot for long-term storage at -20?/-80?. Our default final concentration of glycerol is 50%. Customers could use it as reference.

Uniprot ID: P84811

HGNC Database Link: N/A

UniGene Database Link: N/A

KEGG Database Link: N/A

STRING Database Link: N/A

OMIM Database Link: N/A