Recombinant Hadronyche versuta Omega-hexatoxin-Hv1a | CSB-EP347842HAD

Recombinant Hadronyche versuta Omega-hexatoxin-Hv1a | CSB-EP347842HAD | Cusabio

Alternative Name(s): Omega-atracotoxin-Hv1a Short name: AcTx-Hv1 Short name: Omega-AcTx-Hv1a

Gene Names: N/A

Research Areas: Others

Organism: Hadronyche versuta (Blue mountains funnel-web spider) (Atrax versutus)

AA Sequence: SPTCIPSGQPCPYNENCCSQSCTFKENENGNTVKRCD

Source: E.coli

Tag Info: N-terminal 6xHis-SUMO-tagged

Expression Region: 1-37aa

Sequence Info: Full Length

MW: 20.1 kDa

Purity: Greater than 90% as determined by SDS-PAGE.

Relevance: Reversibly and voltage-independently blocks both mid-low- (M-LVA) and high-voltage-activated (HVA) calcium channels in cockroach DUM neurons. Lethal to many insect orders but not toxic to mice or rabbits. May target the insect high-voltage-activated calcium channel Dmca1D. Also inhibits acarines calcium channels. An extremely high toxin concentration partially inhibits Cav1.2/CACNA1C, Cav2.1/CACNA1A and Cav2.2/CACNA1B calcium channel of rats. As for omega-AcTx-Hv2a, the phenotypic effect of injection of this toxin into lone star ticks (Amblyomma americanum) is curling of all eight legs into closed loops.

Reference: "The structure of a novel insecticidal neurotoxin, omega-atracotoxin-HV1, from the venom of an Australian funnel web spider."Fletcher J.I., Smith R., O'Donoghue S.I., Nilges M., Connor M., Howden M.E.H., Christie M.J., King G.F.Nat. Struct. Biol. 4:559-566(1997)

Storage: The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20?/-80?. The shelf life of lyophilized form is 12 months at -20?/-80?.

Notes: Repeated freezing and thawing is not recommended. Store working aliquots at 4? for up to one week.

Function: Reversibly and voltage-independently blocks both mid-low- (M-LVA) and high-voltage-activated (HVA) calcium channels in cockroach DUM neurons. Lethal to many insect orders but not toxic to mice or rabbits. May target the insect high-voltage-activated calcium channel Dmca1D. Also inhibits acarines calcium channels. An extremely high toxin concentration partially inhibits Cav1.2/CACNA1C, Cav2.1/CACNA1A and Cav2.2/CACNA1B calcium channel of rats. As for omega-AcTx-Hv2a, the phenotypic effect of injection of this toxin into lone star ticks (Amblyomma americanum) is curling of all eight legs into closed loops.

Involvement in disease:

Subcellular Location: Secreted

Protein Families: Shiva superfamily, Omega toxin family

Tissue Specificity: Expressed by the venom gland.

Paythway:

Form: Liquid or Lyophilized powder

Buffer: If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0.

Reconstitution: We recommend that this vial be briefly centrifuged prior to opening to bring the contents to the bottom. Please reconstitute protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL.We recommend to add 5-50% of glycerol (final concentration) and aliquot for long-term storage at -20?/-80?. Our default final concentration of glycerol is 50%. Customers could use it as reference.

Uniprot ID: P56207

HGNC Database Link: N/A

UniGene Database Link: N/A

KEGG Database Link: N/A

STRING Database Link: N/A

OMIM Database Link: N/A