Recombinant Guinea pig Membrane cofactor protein (CD46), partial | CSB-EP004939GU

Recombinant Guinea pig Membrane cofactor protein (CD46), partial | CSB-EP004939GU | Cusabio

Alternative Name(s): CD_antigen: CD46

Gene Names: CD46

Research Areas: Others

Organism: Cavia porcellus (Guinea pig)

AA Sequence: CVLPPPFEAMEPINPKPYYEIGEKVEYRCKKGYLRQPFYLMVATCEKNHSWVPITDDGCIKKQCTYLNPPPKGRVEYINGTRTWGDIVHFSCVEGFYVSGIAALSCELRGDNVDWNGRVPTCEKVLCSPPPKIQNGKYTFSDVQVFEYFEAVTYSCDAVQGPDKLSLVGNEVLYCAGHQKWSSAAPECKVVKCPLPVVKNGKQISGLGQTFFYQATVTFQCLPGFYFNGSSTVVCGSDNTWKPSIPECLKGPKPTHPTKPPVYNYPGYPNPREGIFDQELN

Source: E.coli

Tag Info: N-terminal 6xHis-tagged

Expression Region: 36-316aa

Sequence Info: Extracellular Domain

MW: 35.4 kDa

Purity: Greater than 90% as determined by SDS-PAGE.

Relevance: May be involved in the fusion of the spermatozoa with the oocyte during fertilization.

Reference: "Molecular cloning of guinea pig membrane cofactor protein: preferential expression in testis."Hosokawa M., Nonaka M., Okada N., Nonaka M., Okada H.J. Immunol. 157:4946-4952(1996)

Storage: The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20?/-80?. The shelf life of lyophilized form is 12 months at -20?/-80?.

Notes: Repeated freezing and thawing is not recommended. Store working aliquots at 4? for up to one week.

Function: May be involved in the fusion of the spermatozoa with the oocyte during fertilization.

Involvement in disease:

Subcellular Location: Membrane, Single-pass type I membrane protein

Protein Families:

Tissue Specificity: Preferentially expressed in testis.

Paythway:

Form: Liquid or Lyophilized powder

Buffer: If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0.

Reconstitution: We recommend that this vial be briefly centrifuged prior to opening to bring the contents to the bottom. Please reconstitute protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL.We recommend to add 5-50% of glycerol (final concentration) and aliquot for long-term storage at -20?/-80?. Our default final concentration of glycerol is 50%. Customers could use it as reference.

Uniprot ID: P70105

HGNC Database Link: N/A

UniGene Database Link: N/A

KEGG Database Link: N/A

STRING Database Link: STRING

OMIM Database Link: N/A