Recombinant Griffithsia sp. Griffithsin (X31S) | CSB-YP307563GDJ

Recombinant Griffithsia sp. Griffithsin (X31S) | CSB-YP307563GDJ | Cusabio

Alternative Name(s): /

Gene Names: N/A

Research Areas: others

Organism: Griffithsia sp. (strain Q66D336) (Red alga)

AA Sequence: SLTHRKFGGSGGSPFSGLSSIAVRSGSYLDSIIIDGVHHGGSGGNLSPTFTFGSGEYISNMTIRSGDYIDNISFETNMGRRFGPYGGSGGSANTLSNVKVIQINGSAGDYLDSLDIYYEQY

Source: Yeast

Tag Info: N-terminal 6xHis-tagged

Expression Region: 1-121aa(X31S)

Sequence Info: Full Length

MW: 14.7 kDa

Purity: Greater than 85% as determined by SDS-PAGE.

Relevance: Mixed specificity lectin with anti-HIV activity. Binds to HIV envelope glycoproteins, including exterior membrane glycoprotein gp120, and inhibits viral entry into cells. Binding to gp120 is dependent on gp120 being glycosylated, and is inhibited by mannose, glucose and N-acetylglucosamine.

Reference: "Isolation and characterization of griffithsin, a novel HIV-inactivating protein, from the red alga Griffithsia sp." Mori T., O'Keefe B.R., Sowder R.C. II, Bringans S., Gardella R., Berg S., Cochran P., Turpin J.A., Buckheit R.W. Jr., McMahon J.B., Boyd M.R. J. Biol. Chem. 280:9345-9353(2005)

Storage: The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20?/-80?. The shelf life of lyophilized form is 12 months at -20?/-80?.

Notes: Repeated freezing and thawing is not recommended. Store working aliquots at 4? for up to one week.

Function:

Involvement in disease:

Subcellular Location:

Protein Families:

Tissue Specificity:

Paythway:

Form: Liquid or Lyophilized powder

Buffer: If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0.

Reconstitution: We recommend that this vial be briefly centrifuged prior to opening to bring the contents to the bottom. Please reconstitute protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL.We recommend to add 5-50% of glycerol (final concentration) and aliquot for long-term storage at -20?/-80?. Our default final concentration of glycerol is 50%. Customers could use it as reference.

Uniprot ID: P84801

HGNC Database Link: N/A

UniGene Database Link: N/A

KEGG Database Link: N/A

STRING Database Link: N/A

OMIM Database Link: N/A