Recombinant Glycine max Stress-induced protein SAM22 (PR-10) | CSB-YP333215GGV

Recombinant Glycine max Stress-induced protein SAM22 (PR-10) | CSB-YP333215GGV | Cusabio

Alternative Name(s): PR-10; GLYMA_07G243500; Stress-induced protein SAM22; Pathogenesis-related protein 10; Starvation-associated message 22; allergen Gly m 4

Gene Names: PR-10

Research Areas: Others

Organism: Glycine max (Soybean) (Glycine hispida)

AA Sequence: MGVFTFEDEINSPVAPATLYKALVTDADNVIPKALDSFKSVENVEGNGGPGTIKKITFLEDGETKFVLHKIESIDEANLGYSYSVVGGAALPDTAEKITFDSKLVAGPNGGSAGKLTVKYETKGDAEPNQDELKTGKAKADALFKAIEAYLLAHPDYN

Source: Yeast

Tag Info: N-terminal 6xHis-tagged

Expression Region: 1-158aa

Sequence Info: Full Length

MW: 18.8 kDa

Purity: Greater than 90% as determined by SDS-PAGE.

Relevance:

Reference: Characterization of a stress-induced, developmentally regulated gene family from soybean.Crowell D., John M.E., Russell D., Amasino R.M.Plant Mol. Biol. 18:459-466(1992)

Storage: The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20?/-80?. The shelf life of lyophilized form is 12 months at -20?/-80?.

Notes: Repeated freezing and thawing is not recommended. Store working aliquots at 4? for up to one week.

Function:

Involvement in disease:

Subcellular Location:

Protein Families: BetVI family

Tissue Specificity:

Paythway:

Form: Liquid or Lyophilized powder

Buffer: If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0.

Reconstitution: We recommend that this vial be briefly centrifuged prior to opening to bring the contents to the bottom. Please reconstitute protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL.We recommend to add 5-50% of glycerol (final concentration) and aliquot for long-term storage at -20?/-80?. Our default final concentration of glycerol is 50%. Customers could use it as reference.

Uniprot ID: P26987

HGNC Database Link: N/A

UniGene Database Link: UniGene

KEGG Database Link: KEGG

STRING Database Link: STRING

OMIM Database Link: N/A