Recombinant Glycine max Cell division cycle protein 48 homolog (CDC48), partial | CSB-EP346583GGV

Recombinant Glycine max Cell division cycle protein 48 homolog (CDC48), partial | CSB-EP346583GGV | Cusabio

Alternative Name(s): Valosin-containing protein homolog Short name: VCP

Gene Names: CDC48

Research Areas: Neuroscience

Organism: Glycine max (Soybean) (Glycine hispida)

AA Sequence: DEDSRHQIFKACLRKSPIAKNVDLRALARHTQGFSGADITEICQRACKYAIRENIEKDIERERKSRENPEAMDEDTVDDEVAEIKAAHFEESMKFARRSVSDADIRKYQAFAQTLQQSRGFGSEFRFPESGDRTTTGSDPFAASAGGADEDDLYS

Source: E.coli

Tag Info: N-terminal 6xHis-SUMO-tagged

Expression Region: 653-807aa

Sequence Info: Partial

MW: 33.5 kDa

Purity: Greater than 90% as determined by SDS-PAGE.

Relevance: Probably functions in cell division and growth processes.

Reference: "Identification of cDNA clones encoding valosin-containing protein and other plant plasma membrane-associated proteins by a general immunoscreening strategy."Shi J., Dixon R.A., Gonzales R.A., Kjellbom P., Bhattacharyya M.K.Proc. Natl. Acad. Sci. U.S.A. 92:4457-4461(1995)

Storage: The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20?/-80?. The shelf life of lyophilized form is 12 months at -20?/-80?.

Notes: Repeated freezing and thawing is not recommended. Store working aliquots at 4? for up to one week.

Function: Probably functions in cell division and growth processes.

Involvement in disease:

Subcellular Location: Cell membrane, Peripheral membrane protein

Protein Families: AAA ATPase family

Tissue Specificity:

Paythway:

Form: Liquid or Lyophilized powder

Buffer: If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0.

Reconstitution: We recommend that this vial be briefly centrifuged prior to opening to bring the contents to the bottom. Please reconstitute protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL.We recommend to add 5-50% of glycerol (final concentration) and aliquot for long-term storage at -20?/-80?. Our default final concentration of glycerol is 50%. Customers could use it as reference.

Uniprot ID: P54774

HGNC Database Link: N/A

UniGene Database Link: UniGene

KEGG Database Link: KEGG

STRING Database Link: STRING

OMIM Database Link: N/A