Recombinant Glycine max 2S albumin | CSB-EP324829GGV

Recombinant Glycine max 2S albumin | CSB-EP324829GGV | Cusabio

Alternative Name(s): 2S albumin; GM2S-1; Napin-type 2S albumin 3) [Cleaved into: 2S albumin small chain; Aspartic acid-rich peptide; Lunasin); 2S albumin large chain; 8 kDa methionine-rich protein; 8 kDa MRP)]

Gene Names: N/A

Research Areas: Others

Organism: Glycine max (Soybean) (Glycine hispida)

AA Sequence: SKWQHQQDSCRKQLQGVNLTPCEKHIMEKIQGRGDDDDDDDDDNHILRTMRGRINYIRRNEGKDEDEEEEGHMQKCCTEMSELRSPKCQCKALQKIMENQSEELEEKQKKKMEKELINLATMCRFGPMIQCDLSSDD

Source: E.coli

Tag Info: N-terminal 6xHis-SUMO-tagged

Expression Region: 22-158aa

Sequence Info: Full Length of Mature Protein

MW: 32.2 kDa

Purity: Greater than 90% as determined by SDS-PAGE.

Relevance: This is a 2S seed storage protein.

Reference: A soybean cDNA encoding a chromatin-binding peptide inhibits mitosis of mammalian cells.Galvez A.F., de Lumen B.O.Nat. Biotechnol. 17:495-500(1999)

Storage: The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20?/-80?. The shelf life of lyophilized form is 12 months at -20?/-80?.

Notes: Repeated freezing and thawing is not recommended. Store working aliquots at 4? for up to one week.

Function: This is a 2S seed storage protein.

Involvement in disease:

Subcellular Location:

Protein Families: 2S seed storage albumins family

Tissue Specificity: Expressed in cotyledons (Ref.2). Maximal expression in parenchyma cells undergoing DNA endoreduplication and cell expansion but not in actively dividing cells of the cotyledon (PubMed:10331812).

Paythway:

Form: Liquid or Lyophilized powder

Buffer: If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0.

Reconstitution: We recommend that this vial be briefly centrifuged prior to opening to bring the contents to the bottom. Please reconstitute protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL.We recommend to add 5-50% of glycerol (final concentration) and aliquot for long-term storage at -20?/-80?. Our default final concentration of glycerol is 50%. Customers could use it as reference.

Uniprot ID: P19594

HGNC Database Link: N/A

UniGene Database Link: UniGene

KEGG Database Link: KEGG

STRING Database Link: STRING

OMIM Database Link: N/A