Recombinant Geobacillus stearothermophilus Gellan lyase, partial | CSB-EP308328GFM

(No reviews yet) Write a Review
SKU:
CSB-EP308328GFM
Availability:
3 - 7 Working Days
  • Recombinant Geobacillus stearothermophilus Gellan lyase, partial
  • (Tris-Glycine gel) Discontinuous SDS-PAGE (reduced) with 5% enrichment gel and 15% separation gel.
£281.60 - £1,361.60

Description

Recombinant Geobacillus stearothermophilus Gellan lyase, partial | CSB-EP308328GFM | Cusabio

Alternative Name(s): Gellan lyase; EC 4.2.2.25; Fragments

Gene Names: N/A

Research Areas: Others

Organism: Geobacillus stearothermophilus (Bacillus stearothermophilus)

AA Sequence: LVSESNPGRAIPAGGKGATIRAARPGLATTLNGPKAGNGTTGATKLTTPARPLSEGANMMCDHRAGGNAAISGSSVGEGTARAGDSKVMSRMLSPKGSIIAGTVNMMPADIAAGSVRTPSSLPPDGRSATPMSVSEVASDISHKDGSVNVTKDPVTAAGLTAMRKNANKGSPPASPLPLKADNKGVHINKHWVDLKNDNDFNTR

Source: E.coli

Tag Info: N-terminal 6xHis-tagged

Expression Region: 1-204aa

Sequence Info: Partial

MW: 24.5 kDa

Purity: Greater than 90% as determined by SDS-PAGE.

Relevance: Cleaves the glycosidic bonds of gellan backbone and releases tetrasaccharide units of glucuronyl-glucosyl-rhamnosyl-glucose with unsaturated glucuronic acid at the non-reducing terminal. The enzyme is highly specific to the heteropolysaccharide gellan.

Reference: Physicochemical characteristics of a thermostable gellan lyase from Geobacillus stearothermophilus 98.Derekova A., Atanassova M., Christova P., Tchorbanov B., Shosheva A., Mandeva R., Rodriguez-Alonso P., Garabal J.I., Kambourova M.Z. Naturforsch. C Biosci. 65:231-238(2010)

Storage: The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20?/-80?. The shelf life of lyophilized form is 12 months at -20?/-80?.

Notes: Repeated freezing and thawing is not recommended. Store working aliquots at 4? for up to one week.

Function: Cleaves the glycosidic bonds of gellan backbone and releases tetrasaccharide units of glucuronyl-glucosyl-rhamnosyl-glucose with unsaturated glucuronic acid at the non-reducing terminal. The enzyme is highly specific to the heteropolysaccharide gellan.

Involvement in disease:

Subcellular Location: Secreted

Protein Families:

Tissue Specificity:

Paythway:

Form: Liquid or Lyophilized powder

Buffer: If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0.

Reconstitution: We recommend that this vial be briefly centrifuged prior to opening to bring the contents to the bottom. Please reconstitute protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL.We recommend to add 5-50% of glycerol (final concentration) and aliquot for long-term storage at -20?/-80?. Our default final concentration of glycerol is 50%. Customers could use it as reference.

Uniprot ID: P85513

HGNC Database Link: N/A

UniGene Database Link: N/A

KEGG Database Link: N/A

STRING Database Link: N/A

OMIM Database Link: N/A

View AllClose

0 Reviews

View AllClose