Recombinant Gadus morhua Parvalbumin beta | CSB-EP852688GER

Recombinant Gadus morhua Parvalbumin beta | CSB-EP852688GER | Cusabio

Alternative Name(s): Allergen: Gad m 1

Gene Names: N/A

Research Areas: Allergen

Organism: Gadus morhua (Atlantic cod)

AA Sequence: AFAGILNDADITAALAACKAEGSFDHKAFFTKVGLAAKSPADIKKVFEIIDQDKSDFVEEDELKLFLQNFSAGARALSDAETKVFLKAGDSDGDGKIGVDEFGAMIKA

Source: E.coli

Tag Info: N-terminal 6xHis-SUMO-tagged

Expression Region: 2-109aa

Sequence Info: Full Length of Mature Protein

MW: 27.4 kDa

Purity: Greater than 90% as determined by SDS-PAGE.

Relevance: In muscle, parvalbumin is thought to be involved in relaxation after contraction. It binds two calcium ions

Reference: "The major allergen (parvalbumin) of codfish is encoded by at least two isotypic genes: cDNA cloning, expression and antibody binding of the recombinant allergens."Van Do T., Hordvik I., Endresen C., Elsayed S.Mol. Immunol. 39:595-602(2003)

Storage: The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20?/-80?. The shelf life of lyophilized form is 12 months at -20?/-80?.

Notes: Repeated freezing and thawing is not recommended. Store working aliquots at 4? for up to one week.

Function: In muscle, parvalbumin is thought to be involved in relaxation after contraction. It binds two calcium ions (By similarity).

Involvement in disease:

Subcellular Location:

Protein Families: Parvalbumin family

Tissue Specificity:

Paythway:

Form: Liquid or Lyophilized powder

Buffer: If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0.

Reconstitution: We recommend that this vial be briefly centrifuged prior to opening to bring the contents to the bottom. Please reconstitute protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL.We recommend to add 5-50% of glycerol (final concentration) and aliquot for long-term storage at -20?/-80?. Our default final concentration of glycerol is 50%. Customers could use it as reference.

Uniprot ID: Q90YK9

HGNC Database Link: N/A

UniGene Database Link: N/A

KEGG Database Link: N/A

STRING Database Link: N/A

OMIM Database Link: N/A