Recombinant Escherichia coli Transposase insE for insertion sequence IS3A (insE1) | CSB-MP317177ENV

(No reviews yet) Write a Review
SKU:
CSB-MP317177ENV
Availability:
18 - 28 Working Days
  • Recombinant Escherichia coli Transposase insE for insertion sequence IS3A (insE1)
  • (Tris-Glycine gel) Discontinuous SDS-PAGE (reduced) with 5% enrichment gel and 15% separation gel.
£340.00 - £808.00

Description

Recombinant Escherichia coli Transposase insE for insertion sequence IS3A (insE1) | CSB-MP317177ENV | Cusabio

Alternative Name(s): insE1; b0298; JW5036; Transposase InsE for insertion sequence IS3A

Gene Names: insE1

Research Areas: Microbiology

Organism: Escherichia coli (strain K12)

AA Sequence: MTKTVSTSKKPRKQHSPEFRSEALKLAERIGVTAAARELSLYESQLYNWRSKQQNQQTSSERELEMSTEIARLKRQLAERDEELAILQKAATYFAKRLK

Source: Mammalian cell

Tag Info: C-terminal hFc-tagged

Expression Region: 1-99aa

Sequence Info: Full Length

MW: 37.5 kDa

Purity: Greater than 90% as determined by SDS-PAGE.

Relevance: Involved in the transposition of the insertion sequence IS3.

Reference: "The complete genome sequence of Escherichia coli K-12."Blattner F.R., Plunkett G. III, Bloch C.A., Perna N.T., Burland V., Riley M., Collado-Vides J., Glasner J.D., Rode C.K., Mayhew G.F., Gregor J., Davis N.W., Kirkpatrick H.A., Goeden M.A., Rose D.J., Mau B., Shao Y.Science 277:1453-1462(1997)

Storage: The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20?/-80?. The shelf life of lyophilized form is 12 months at -20?/-80?.

Notes: Repeated freezing and thawing is not recommended. Store working aliquots at 4? for up to one week.

Function: Involved in the transposition of the insertion sequence IS3.

Involvement in disease:

Subcellular Location:

Protein Families: Transposase 8 family

Tissue Specificity:

Paythway:

Form: Liquid or Lyophilized powder

Buffer: If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0.

Reconstitution: We recommend that this vial be briefly centrifuged prior to opening to bring the contents to the bottom. Please reconstitute protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL.We recommend to add 5-50% of glycerol (final concentration) and aliquot for long-term storage at -20?/-80?. Our default final concentration of glycerol is 50%. Customers could use it as reference.

Uniprot ID: P0CF66

HGNC Database Link: N/A

UniGene Database Link: N/A

KEGG Database Link: KEGG

STRING Database Link: STRING

OMIM Database Link: N/A

View AllClose

0 Reviews

View AllClose