Recombinant Escherichia coli Thiosulfate sulfurtransferase GlpE (glpE) | CSB-EP533026ENP

(No reviews yet) Write a Review
SKU:
CSB-EP533026ENP
Availability:
13 - 23 Working Days
  • Recombinant Escherichia coli Thiosulfate sulfurtransferase GlpE (glpE)
  • (Tris-Glycine gel) Discontinuous SDS-PAGE (reduced) with 5% enrichment gel and 15% separation gel.
£281.60 - £1,361.60

Description

Recombinant Escherichia coli Thiosulfate sulfurtransferase GlpE (glpE) | CSB-EP533026ENP | Cusabio

Alternative Name(s): glpE; EcolC_0289; Thiosulfate sulfurtransferase GlpE; EC 2.8.1.1

Gene Names: glpE

Research Areas: Microbiology

Organism: Escherichia coli (strain ATCC 8739 / DSM 1576 / Crooks)

AA Sequence: MDQFECINVADAHQKLQEKEAVLVDIRDPQSFAMGHAVQAFHLTNDTLGAFMRDNDFDTPVMVMCYHGNSSKGAAQYLLQQGYDVVYSIDGGFEVWQRQFPAEVAYGA

Source: E.coli

Tag Info: N-terminal 6xHis-tagged

Expression Region: 1-108aa

Sequence Info: Full Length

MW: 16.1 kDa

Purity: Greater than 90% as determined by SDS-PAGE.

Relevance: Catalyzes, although with low efficiency, the sulfur transfer reaction from thiosulfate to cyanide.

Reference: "Complete sequence of Escherichia coli C str. ATCC 8739."Copeland A., Lucas S., Lapidus A., Glavina del Rio T., Dalin E., Tice H., Bruce D., Goodwin L., Pitluck S., Kiss H., Brettin T., Detter J.C., Han C., Kuske C.R., Schmutz J., Larimer F., Land M., Hauser L. Richardson P.Submitted (FEB-2008).

Storage: The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20?/-80?. The shelf life of lyophilized form is 12 months at -20?/-80?.

Notes: Repeated freezing and thawing is not recommended. Store working aliquots at 4? for up to one week.

Function: Catalyzes, although with low efficiency, the sulfur transfer reaction from thiosulfate to cyanide.

Involvement in disease:

Subcellular Location: Cytoplasm

Protein Families: GlpE family

Tissue Specificity:

Paythway:

Form: Liquid or Lyophilized powder

Buffer: If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0.

Reconstitution: We recommend that this vial be briefly centrifuged prior to opening to bring the contents to the bottom. Please reconstitute protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL.We recommend to add 5-50% of glycerol (final concentration) and aliquot for long-term storage at -20?/-80?. Our default final concentration of glycerol is 50%. Customers could use it as reference.

Uniprot ID: B1IP41

HGNC Database Link: N/A

UniGene Database Link: N/A

KEGG Database Link: KEGG

STRING Database Link: N/A

OMIM Database Link: N/A

View AllClose

0 Reviews

View AllClose