Recombinant Escherichia coli Prophage outer membrane lipoprotein RzoR (rzoR) | CSB-EP349921ENVg1

(No reviews yet) Write a Review
SKU:
CSB-EP349921ENVg1
Availability:
3 - 7 Working Days
£281.60 - £1,361.60

Description

Recombinant Escherichia coli Prophage outer membrane lipoprotein RzoR (rzoR) | CSB-EP349921ENVg1 | Cusabio

Alternative Name(s): Outer membrane lipoprotein Rz1 from lambdoid prophage Rac (Spanin from lambdoid prophage Rac, outer membrane subunit) (o-spanin)

Gene Names: rzoR

Research Areas: Others

Organism: Escherichia coli (strain K12)

AA Sequence: CTSKQSVSQCVKPPPPPAWIMQPPPDWQTPLNGIISPSGNDW

Source: E.coli

Tag Info: N-terminal 6xHis-Flag-tagged

Expression Region: 20-61aa

Sequence Info: Full Length of Mature Protein

MW: 11.5 kDa

Purity: Greater than 85% as determined by SDS-PAGE.

Relevance: Component of the spanin complex that disrupts the outer membrane and causes cell lysis during virus exit. The spanin complex conducts the final step in cell lysis by disrupting the outer membrane after holin and endolysin action have permeabilized the inner membrane and degraded the host peptidoglycans.

Reference: "Highly accurate genome sequences of Escherichia coli K-12 strains MG1655 and W3110." Hayashi K., Morooka N., Yamamoto Y., Fujita K., Isono K., Choi S., Ohtsubo E., Baba T., Wanner B.L., Mori H., Horiuchi T. Mol. Syst. Biol. 2:E1-E5(2006)

Storage: The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20?/-80?. The shelf life of lyophilized form is 12 months at -20?/-80?.

Notes: Repeated freezing and thawing is not recommended. Store working aliquots at 4? for up to one week.

Function:

Involvement in disease:

Subcellular Location:

Protein Families:

Tissue Specificity:

Paythway:

Form: Liquid or Lyophilized powder

Buffer: If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0.

Reconstitution: We recommend that this vial be briefly centrifuged prior to opening to bring the contents to the bottom. Please reconstitute protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL.We recommend to add 5-50% of glycerol (final concentration) and aliquot for long-term storage at -20?/-80?. Our default final concentration of glycerol is 50%. Customers could use it as reference.

Uniprot ID: P58042

HGNC Database Link: N/A

UniGene Database Link: N/A

KEGG Database Link: N/A

STRING Database Link: N/A

OMIM Database Link: N/A

View AllClose

0 Reviews

View AllClose