Recombinant Escherichia coli Periplasmic serine endoprotease DegP (degP) | CSB-EP314631ENV

(No reviews yet) Write a Review
SKU:
CSB-EP314631ENV
Availability:
13 - 23 Working Days
  • Recombinant Escherichia coli Periplasmic serine endoprotease DegP (degP)
  • (Tris-Glycine gel) Discontinuous SDS-PAGE (reduced) with 5% enrichment gel and 15% separation gel.
£281.60 - £1,361.60

Description

Recombinant Escherichia coli Periplasmic serine endoprotease DegP (degP) | CSB-EP314631ENV | Cusabio

Alternative Name(s): Heat shock protein DegPProtease Do

Gene Names: degP

Research Areas: Others

Organism: Escherichia coli (strain K12)

AA Sequence: AETSSATTAQQMPSLAPMLEKVMPSVVSINVEGSTTVNTPRMPRNFQQFFGDDSPFCQEGSPFQSSPFCQGGQGGNGGGQQQKFMALGSGVIIDADKGYVVTNNHVVDNATVIKVQLSDGRKFDAKMVGKDPRSDIALIQIQNPKNLTAIKMADSDALRVGDYTVAIGNPFGLGETVTSGIVSALGRSGLNAENYENFIQTDAAINRGNSGGALVNLNGELIGINTAILAPDGGNIGIGFAIPSNMVKNLTSQMVEYGQVKRGELGIMGTELNSELAKAMKVDAQRGAFVSQVLPNSSAAKAGIKAGDVITSLNGKPISSFAALRAQVGTMPVGSKLTLGLLRDGKQVNVNLELQQSSQNQVDSSSIFNGIEGAEMSNKGKDQGVVVNNVKTGTPAAQIGLKKGDVIIGANQQAVKNIAELRKVLDSKPSVLALNIQRGDSTIYLLMQ

Source: E.coli

Tag Info: N-terminal 6xHis-SUMO-tagged

Expression Region: 27-474aa

Sequence Info: Full Length of Mature Protein

MW: 62.8 kDa

Purity: Greater than 90% as determined by SDS-PAGE.

Relevance: DegP acts as a chaperone at low tperatures but switches to a peptidase (heat shock protein) at higher tperatures. It degrades transiently denatured and unfolded proteins which accumulate in the periplasm following heat shock or other stress conditions. DegP is efficient with Val-Xaa and Ile-Xaa peptide bonds, suggesting a preference for beta-branched side chain amino acids. Only unfolded proteins devoid of disulfide bonds appear capable of being cleaved, thereby preventing non-specific proteolysis of folded proteins. Its proteolytic activity is essential for the survival of cells at elevated tperatures. It can degrade IciA, ada, casein, globin and PapA. DegP shares specificity with DegQ. DegP is also involved in the biogenesis of partially folded outer-mbrane proteins (OMP).

Reference: Covalent linkage of distinct substrate degrons controls assembly and disassembly of DegP proteolytic cages.Kim S., Grant R.A., Sauer R.T.Cell 145:67-78(2011)

Storage: The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20?/-80?. The shelf life of lyophilized form is 12 months at -20?/-80?.

Notes: Repeated freezing and thawing is not recommended. Store working aliquots at 4? for up to one week.

Function: DegP acts as a chaperone at low temperatures but switches to a peptidase (heat shock protein) at higher temperatures

Involvement in disease:

Subcellular Location: Cell inner membrane, Peripheral membrane protein, Cytoplasmic side

Protein Families: Peptidase S1C family

Tissue Specificity:

Paythway:

Form: Liquid or Lyophilized powder

Buffer: If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0.

Reconstitution: We recommend that this vial be briefly centrifuged prior to opening to bring the contents to the bottom. Please reconstitute protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL.We recommend to add 5-50% of glycerol (final concentration) and aliquot for long-term storage at -20?/-80?. Our default final concentration of glycerol is 50%. Customers could use it as reference.

Uniprot ID: P0C0V0

HGNC Database Link: N/A

UniGene Database Link: N/A

KEGG Database Link: KEGG

STRING Database Link: STRING

OMIM Database Link: N/A

View AllClose

0 Reviews

View AllClose