Recombinant Escherichia coli O9:H4 Outer-membrane lipoprotein carrier protein (lolA) | CSB-YP419575EJF

(No reviews yet) Write a Review
SKU:
CSB-YP419575EJF
Availability:
3 - 7 Working Days
  • Recombinant Escherichia coli O9:H4 Outer-membrane lipoprotein carrier protein (lolA)
  • (Tris-Glycine gel) Discontinuous SDS-PAGE (reduced) with 5% enrichment gel and 15% separation gel.
£306.40 - £1,076.00

Description

Recombinant Escherichia coli O9:H4 Outer-membrane lipoprotein carrier protein (lolA) | CSB-YP419575EJF | Cusabio

Alternative Name(s): lolA; EcHS_A0996; Outer-membrane lipoprotein carrier protein

Gene Names: lolA

Research Areas: Others

Organism: Escherichia coli O9:H4 (strain HS)

AA Sequence: DAASDLKSRLDKVSSFHASFTQKVTDGSGAAVQEGQGDLWVKRPNLFNWHMTQPDESILVSDGKTLWFYNPFVEQATATWLKDATGNTPFMLIARNQSSDWQQYNIKQNGDDFVLTPKASNGNLKQFTINVGRDGTIHQFSAVEQDDQRSSYQLKSQQNGAVDAAKFTFTPPQGVTVDDQRK

Source: Yeast

Tag Info: N-terminal 6xHis-tagged

Expression Region: 22-203aa

Sequence Info: Full Length of Mature Protein

MW: 22.3 kDa

Purity: Greater than 90% as determined by SDS-PAGE.

Relevance: Participates in the translocation of lipoproteins from the inner mbrane to the outer mbrane. Only forms a complex with a lipoprotein if the residue after the N-terminal Cys is not an aspartate (The Asp acts as a targeting signal to indicate that the lipoprotein should stay in the inner mbrane).

Reference: The pangenome structure of Escherichia coli comparative genomic analysis of E. coli commensal and pathogenic isolates.Rasko D.A., Rosovitz M.J., Myers G.S.A., Mongodin E.F., Fricke W.F., Gajer P., Crabtree J., Sebaihia M., Thomson N.R., Chaudhuri R., Henderson I.R., Sperandio V., Ravel J.J. Bacteriol. 190:6881-6893(2008)

Storage: The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20?/-80?. The shelf life of lyophilized form is 12 months at -20?/-80?.

Notes: Repeated freezing and thawing is not recommended. Store working aliquots at 4? for up to one week.

Function: Participates in the translocation of lipoproteins from the inner membrane to the outer membrane. Only forms a complex with a lipoprotein if the residue after the N-terminal Cys is not an aspartate (The Asp acts as a targeting signal to indicate that the lipoprotein should stay in the inner membrane).

Involvement in disease:

Subcellular Location: Periplasm

Protein Families: LolA family

Tissue Specificity:

Paythway:

Form: Liquid or Lyophilized powder

Buffer: If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0.

Reconstitution: We recommend that this vial be briefly centrifuged prior to opening to bring the contents to the bottom. Please reconstitute protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL.We recommend to add 5-50% of glycerol (final concentration) and aliquot for long-term storage at -20?/-80?. Our default final concentration of glycerol is 50%. Customers could use it as reference.

Uniprot ID: A7ZYJ5

HGNC Database Link: N/A

UniGene Database Link: N/A

KEGG Database Link: KEGG

STRING Database Link: N/A

OMIM Database Link: N/A

View AllClose

0 Reviews

View AllClose