Recombinant Escherichia coli Major outer membrane lipoprotein Lpp (lpp) | CSB-EP300885ENV

Recombinant Escherichia coli Major outer membrane lipoprotein Lpp (lpp) | CSB-EP300885ENV | Cusabio

Alternative Name(s): Braun lipoprotein (Murein-lipoprotein) (mlpA) (mulI)

Gene Names: lpp

Research Areas: Signal Transduction

Organism: Escherichia coli (strain K12)

AA Sequence: CSSNAKIDQLSSDVQTLNAKVDQLSNDVNAMRSDVQAAKDDAARANQRLDNMATKYRK

Source: E.coli

Tag Info: N-terminal 6xHis-KSI-tagged

Expression Region: 21-78aa

Sequence Info: Full Length of Mature Protein

MW: 21.8 kDa

Purity: Greater than 85% as determined by SDS-PAGE.

Relevance: Interacts with the peptidoglycan both covalently and noncovalently. This interaction contributes to the maintenance of the structural and functional integrity of the cell envelope.

Reference: "Roles of the hydrophobic cavity and lid of LolA in the lipoprotein transfer reaction in Escherichia coli." Watanabe S., Matsuyama S., Tokuda H. J. Biol. Chem. 281:3335-3342(2006)

Storage: The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20?/-80?. The shelf life of lyophilized form is 12 months at -20?/-80?.

Notes: Repeated freezing and thawing is not recommended. Store working aliquots at 4? for up to one week.

Function: Interacts with the peptidoglycan both covalently and noncovalently. This interaction contributes to the maintenance of the structural and functional integrity of the cell envelope.

Involvement in disease:

Subcellular Location: Cell outer membrane, Lipid-anchor, Cell outer membrane, Peptidoglycan-anchor

Protein Families: Lpp family

Tissue Specificity:

Paythway:

Form: Liquid or Lyophilized powder

Buffer: If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0.

Reconstitution: We recommend that this vial be briefly centrifuged prior to opening to bring the contents to the bottom. Please reconstitute protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL.We recommend to add 5-50% of glycerol (final concentration) and aliquot for long-term storage at -20?/-80?. Our default final concentration of glycerol is 50%. Customers could use it as reference.

Uniprot ID: P69776

HGNC Database Link: N/A

UniGene Database Link: N/A

KEGG Database Link: KEGG

STRING Database Link: STRING

OMIM Database Link: N/A