Recombinant Escherichia coli Lipopolysaccharide export system protein lptA (lptA) | CSB-EP360010ENV

Recombinant Escherichia coli Lipopolysaccharide export system protein lptA (lptA) | CSB-EP360010ENV | Cusabio

Alternative Name(s): lptA; yhbN; b3200; JW3167; Lipopolysaccharide export system protein LptA

Gene Names: lptA

Research Areas: Others

Organism: Escherichia coli (strain K12)

AA Sequence: VTGDTDQPIHIESDQQSLDMQGNVVTFTGNVIVTQGTIKINADKVVVTRPGGEQGKEVIDGYGKPATFYQMQDNGKPVEGHASQMHYELAKDFVVLTGNAYLQQVDSNIKGDKITYLVKEQKMQAFSDKGKRVTTVLVPSQLQDKNNKGQTPAQKKGN

Source: E.coli

Tag Info: N-terminal 6xHis-SUMO-tagged

Expression Region: 28-185aa

Sequence Info: Full Length of Mature Protein

MW: 33.3 kDa

Purity: Greater than 90% as determined by SDS-PAGE.

Relevance: Involved in the assbly of lipopolysaccharide (LPS). Required for the translocation of LPS from the inner mbrane to the outer mbrane. May form a bridge between the inner mbrane and the outer mbrane, via interactions with LptC and LptD, thereby facilitating LPS transfer across the periplasm.

Reference: Characterization of interactions between LPS transport proteins of the Lpt system.Bowyer A., Baardsnes J., Ajamian E., Zhang L., Cygler M.Biochem. Biophys. Res. Commun. 404:1093-1098(2011)

Storage: The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20?/-80?. The shelf life of lyophilized form is 12 months at -20?/-80?.

Notes: Repeated freezing and thawing is not recommended. Store working aliquots at 4? for up to one week.

Function: Involved in the assembly of lipopolysaccharide (LPS). Required for the translocation of LPS from the inner membrane to the outer membrane. May form a bridge between the inner membrane and the outer membrane, via interactions with LptC and LptD, thereby facilitating LPS transfer across the periplasm.

Involvement in disease:

Subcellular Location: Periplasm

Protein Families: LptA family

Tissue Specificity:

Paythway:

Form: Liquid or Lyophilized powder

Buffer: If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0.

Reconstitution: We recommend that this vial be briefly centrifuged prior to opening to bring the contents to the bottom. Please reconstitute protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL.We recommend to add 5-50% of glycerol (final concentration) and aliquot for long-term storage at -20?/-80?. Our default final concentration of glycerol is 50%. Customers could use it as reference.

Uniprot ID: P0ADV1

HGNC Database Link: N/A

UniGene Database Link: N/A

KEGG Database Link: KEGG

STRING Database Link: STRING

OMIM Database Link: N/A