Recombinant Escherichia coli Lipopolysaccharide assembly protein B (lapB), partial | CSB-EP359577ENV

Recombinant Escherichia coli Lipopolysaccharide assembly protein B (lapB), partial | CSB-EP359577ENV | Cusabio

Alternative Name(s): lapB; yciM; b1280; JW1272; Lipopolysaccharide assembly protein B; Lipopolysaccharide regulatory protein

Gene Names: lapB

Research Areas: Others

Organism: Escherichia coli (strain K12)

AA Sequence: WYMGRRSAQQNKQDEANRLSRDYVAGVNFLLSNQQDKAVDLFLDMLKEDTGTVEAHLTLGNLFRSRGEVDRAIRIHQTLMESASLTYEQRLLAIQQLGRDYMAAGLYDRAEDMFNQLTDETDFRIGALQQLLQIYQATSEWQKAIDVAERLVKLGKDKQRVEIAHFYCELALQHMASDDLDRAMTLLKKGAAADKNSARVSIMMGRVFMAKGEYAKAVESLQRVISQDRELVSETLEMLQTCYQQLGKTAEWAEFLQRAVEENTGADAELMLADIIEARDGSEAAQVYITRQLQRHPTMRVFHKLMDYHLNEAEEGRAKESLMVLRDMVGEKVRSKPRYRCQKCGFTAYTLYWHCPSCRAWSTIKPIRGLDGL

Source: E.coli

Tag Info: N-terminal 6xHis-SUMO-tagged

Expression Region: 17-389aa

Sequence Info: Partial

MW: 58.8 kDa

Purity: Greater than 90% as determined by SDS-PAGE.

Relevance: Modulates cellular lipopolysaccharide (LPS) levels by regulating LpxC, which is involved in lipid A biosynthesis. May act by modulating the proteolytic activity of FtsH towards LpxC. May also coordinate assembly of proteins involved in LPS synthesis at the plasma membrane.

Reference: "Complete genome sequences of Escherichia coli strains 1303 and ECC-1470 isolated from bovine mastitis."Leimbach A., Poehlein A., Daniel R., Dobrindt U.Submitted (DEC-2014)

Storage: The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20?/-80?. The shelf life of lyophilized form is 12 months at -20?/-80?.

Notes: Repeated freezing and thawing is not recommended. Store working aliquots at 4? for up to one week.

Function:

Involvement in disease:

Subcellular Location:

Protein Families:

Tissue Specificity:

Paythway:

Form: Liquid or Lyophilized powder

Buffer: If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0.

Reconstitution: We recommend that this vial be briefly centrifuged prior to opening to bring the contents to the bottom. Please reconstitute protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL.We recommend to add 5-50% of glycerol (final concentration) and aliquot for long-term storage at -20?/-80?. Our default final concentration of glycerol is 50%. Customers could use it as reference.

Uniprot ID: P0AB58

HGNC Database Link: N/A

UniGene Database Link: N/A

KEGG Database Link: N/A

STRING Database Link: N/A

OMIM Database Link: N/A