Recombinant Escherichia coli K99 fimbrial protein (fanC) | CSB-EP322992ENLe1

(No reviews yet) Write a Review
SKU:
CSB-EP322992ENLe1
Availability:
3 - 7 Working Days
  • Recombinant Escherichia coli K99 fimbrial protein (fanC)
  • (Tris-Glycine gel) Discontinuous SDS-PAGE (reduced) with 5% enrichment gel and 15% separation gel.
$552.00 - $2,172.00

Description

Recombinant Escherichia coli K99 fimbrial protein (fanC) | CSB-EP322992ENLe1 | Cusabio

Alternative Name(s): fanCK99 fimbrial protein

Gene Names: fanC

Research Areas: Others

Organism: Escherichia coli

AA Sequence: NTGTINFNGKITSATCTIDPEVNGNRTSTIDLGQAAISGHGTVVDFKLKPAPGSNDCLAKTNARIDWSGSMNSLGFNNTASGNTAAKGYHMTLRATNVGNGSGGANINTSFTTAEYTHTSAIQSFNYSAQLKKDDRAPSNGGYKAGVFTTSASFLVTYM

Source: E.coli

Tag Info: Tag-Free

Expression Region: 23-181aa

Sequence Info: Full Length of Mature Protein

MW: 16.5 kDa

Purity: Greater than 90% as determined by SDS-PAGE.

Relevance: Fimbriae (also called pili), polar filaments radiating from the surface of the bacterium to a length of 0.5-1.5 micrometers and numbering 100-300 per cell, enable bacteria to colonize the epithelium of specific host organs. FanC is the main component of the K99 fimbriae.

Reference: "The penultimate tyrosine residue of the K99 fibrillar subunit is essential for stability of the protein and its interaction with the periplasmic carrier protein." Simons B.L., Rathman P., Maij C.R., Oudega B., de Graaf F.K. FEMS Microbiol. Lett. 55:107-112(1990)

Storage: The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20?/-80?. The shelf life of lyophilized form is 12 months at -20?/-80?.

Notes: Repeated freezing and thawing is not recommended. Store working aliquots at 4? for up to one week.

Function: Fimbriae (also called pili), polar filaments radiating from the surface of the bacterium to a length of 0.5-1.5 micrometers and numbering 100-300 per cell, enable bacteria to colonize the epithelium of specific host organs.; FUNCTION

Involvement in disease:

Subcellular Location: Fimbrium

Protein Families: Fimbrial protein family

Tissue Specificity:

Paythway:

Form: Liquid or Lyophilized powder

Buffer: If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0.

Reconstitution: We recommend that this vial be briefly centrifuged prior to opening to bring the contents to the bottom. Please reconstitute protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL.We recommend to add 5-50% of glycerol (final concentration) and aliquot for long-term storage at -20?/-80?. Our default final concentration of glycerol is 50%. Customers could use it as reference.

Uniprot ID: P18103

HGNC Database Link: N/A

UniGene Database Link: N/A

KEGG Database Link: N/A

STRING Database Link: N/A

OMIM Database Link: N/A

View AllClose

0 Reviews

View AllClose