Recombinant Escherichia coli Hemolysin E, chromosomal (hlyE), partial | CSB-EP303529ENV1

(No reviews yet) Write a Review
SKU:
CSB-EP303529ENV1
Availability:
3 - 7 Working Days
  • Recombinant Escherichia coli Hemolysin E, chromosomal (hlyE), partial
  • (Tris-Glycine gel) Discontinuous SDS-PAGE (reduced) with 5% enrichment gel and 15% separation gel.
$422.40 - $2,042.40

Description

Recombinant Escherichia coli Hemolysin E, chromosomal (hlyE), partial | CSB-EP303529ENV1 | Cusabio

Alternative Name(s): Cytotoxin ClyA;Hemolysis-inducing protein;Latent pore-forming 34 kDa hemolysin;Silent hemolysin SheA

Gene Names: hlyE

Research Areas: Others

Organism: Escherichia coli (strain K12)

AA Sequence: TEIVADKTVEVVKNAIETADGALDLYNKYLDQVIPWQTFDETIKELSRFKQEYSQAASVLVGDIKTLLMDSQDKYFEATQTVYEWCGVATQLLAAYILLFDEYNEKKASAQKDILIKVLDDGITKLNEAQKSLLVSSQSFNNASGKLLALDSQLTNDFSEKSSYFQSQVDKIRKEAYAGAA

Source: E.coli

Tag Info: C-terminal 6xHis-tagged

Expression Region: 2-182aa

Sequence Info: Partial

MW: 21.2 kDa

Purity: Greater than 90% as determined by SDS-PAGE.

Relevance: Toxin, which has some hemolytic activity towards mammalian cells. Acts by forming a pore-like structure upon contact with mammalian cells.

Reference: "Vesicle-mediated export and assembly of pore-forming oligomers of the enterobacterial clyA cytotoxin." Wai S.N., Lindmark B., Soederblom T., Takade A., Westermark M., Oscarsson J., Jass J., Richter-Dahlfors A., Mizunoe Y., Uhlin B.E. Cell 115:25-35(2003)

Storage: The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20?/-80?. The shelf life of lyophilized form is 12 months at -20?/-80?.

Notes: Repeated freezing and thawing is not recommended. Store working aliquots at 4? for up to one week.

Function:

Involvement in disease:

Subcellular Location:

Protein Families:

Tissue Specificity:

Paythway:

Form: Liquid or Lyophilized powder

Buffer: If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0.

Reconstitution: We recommend that this vial be briefly centrifuged prior to opening to bring the contents to the bottom. Please reconstitute protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL.We recommend to add 5-50% of glycerol (final concentration) and aliquot for long-term storage at -20?/-80?. Our default final concentration of glycerol is 50%. Customers could use it as reference.

Uniprot ID: P77335

HGNC Database Link: N/A

UniGene Database Link: N/A

KEGG Database Link: N/A

STRING Database Link: N/A

OMIM Database Link: N/A

View AllClose

0 Reviews

View AllClose