Recombinant Escherichia coli Heat-labile enterotoxin B chain (eltB) | CSB-EP315643ENL

Recombinant Escherichia coli Heat-labile enterotoxin B chain (eltB) | CSB-EP315643ENL | Cusabio

Alternative Name(s): LT-B, human;LTH-B

Gene Names: eltB

Research Areas: Others

Organism: Escherichia coli

AA Sequence: APQSITELCSEYHNTQIYTINDKILSYTESMAGKREMVIITFKSGATFQVEVPGSQHIDSQKKAIERMKDTLRITYLTETKIDKLCVWNNKTPNSIAAISMEN

Source: E.coli

Tag Info: N-terminal 6xHis-tagged and C-terminal 6xHis-tagged

Expression Region: 22-124aa

Sequence Info: Full Length of Mature Protein

MW: 17 kDa

Purity: Greater than 90% as determined by SDS-PAGE.

Relevance: The biological activity of the toxin is produced by the A chain, which activates intracellular adenyl cyclase.

Reference: Crystal structure of the B subunit of Escherichia coli heat-labile enterotoxin carrying peptides with anti-herpes simplex virus type 1 activity.Matkovic-Calogovic D., Loregian A., D'Acunto M.R., Battistutta R., Tossi A., Palu G., Zanotti G.J. Biol. Chem. 274:8764-8769(1999)

Storage: The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20?/-80?. The shelf life of lyophilized form is 12 months at -20?/-80?.

Notes: Repeated freezing and thawing is not recommended. Store working aliquots at 4? for up to one week.

Function: The biological activity of the toxin is produced by the A chain, which activates intracellular adenyl cyclase.

Involvement in disease:

Subcellular Location:

Protein Families:

Tissue Specificity:

Paythway:

Form: Liquid or Lyophilized powder

Buffer: If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0.

Reconstitution: We recommend that this vial be briefly centrifuged prior to opening to bring the contents to the bottom. Please reconstitute protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL.We recommend to add 5-50% of glycerol (final concentration) and aliquot for long-term storage at -20?/-80?. Our default final concentration of glycerol is 50%. Customers could use it as reference.

Uniprot ID: P0CK94

HGNC Database Link: N/A

UniGene Database Link: N/A

KEGG Database Link: N/A

STRING Database Link: N/A

OMIM Database Link: N/A