Cusabio Escherichia coli Recombinants
Recombinant Escherichia coli Ferric uptake regulation protein (fur) | CSB-YP364302ENV
- SKU:
- CSB-YP364302ENV
- Availability:
- 25 - 35 Working Days
Description
Recombinant Escherichia coli Ferric uptake regulation protein (fur) | CSB-YP364302ENV | Cusabio
Alternative Name(s): Short name:Ferric uptake regulator
Gene Names: fur
Research Areas: Microbiology
Organism: Escherichia coli (strain K12)
AA Sequence: TDNNTALKKAGLKVTLPRLKILEVLQEPDNHHVSAEDLYKRLIDMGEEIGLATVYRVLNQFDDAGIVTRHNFEGGKSVFELTQQHHHDHLICLDCGKVIEFSDDSIEARQREIAAKHGIRLTNHSLYLYGHCAEGDCREDEHAHEGK
Source: Yeast
Tag Info: N-terminal 6xHis-tagged
Expression Region: 2-148aa
Sequence Info: Full Length of Mature Protein
MW: 18.7 kDa
Purity: Greater than 90% as determined by SDS-PAGE.
Relevance: Acts as a global negative controlling element, employing Fe2+ as a cofactor to bind the operator of the repressed genes. Regulates the expression of several outer-membrane proteins including the iron transport operon.
Reference: "Highly accurate genome sequences of Escherichia coli K-12 strains MG1655 and W3110."Hayashi K., Morooka N., Yamamoto Y., Fujita K., Isono K., Choi S., Ohtsubo E., Baba T., Wanner B.L., Mori H., Horiuchi T.Mol. Syst. Biol. 2:E1-E5(2006)
Storage: The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20?/-80?. The shelf life of lyophilized form is 12 months at -20?/-80?.
Notes: Repeated freezing and thawing is not recommended. Store working aliquots at 4? for up to one week.
Function: Acts as a global negative controlling element, employing Fe(2+) as a cofactor to bind the operator of the repressed genes. Regulates the expression of several outer-membrane proteins including the iron transport operon.
Involvement in disease:
Subcellular Location: Cytoplasm
Protein Families: Fur family
Tissue Specificity:
Paythway:
Form: Liquid or Lyophilized powder
Buffer: If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0.
Reconstitution: We recommend that this vial be briefly centrifuged prior to opening to bring the contents to the bottom. Please reconstitute protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL.We recommend to add 5-50% of glycerol (final concentration) and aliquot for long-term storage at -20?/-80?. Our default final concentration of glycerol is 50%. Customers could use it as reference.
Uniprot ID: P0A9A9
HGNC Database Link: N/A
UniGene Database Link: N/A
KEGG Database Link: KEGG
STRING Database Link: STRING
OMIM Database Link: N/A