Recombinant Escherichia coli F41 fimbrial protein (FimF41a) | CSB-EP320917ENL

Recombinant Escherichia coli F41 fimbrial protein (FimF41a) | CSB-EP320917ENL | Cusabio

Alternative Name(s): Adhesin F41

Gene Names: FimF41a

Research Areas: Microbiology

Organism: Escherichia coli

AA Sequence: ADWTEGQPGDIIIGGEITSPSVKWLWKTGEGLSSFSNTTNEIVKRKLNISVPTDELFLAAKMSDGIKGVFVGNTLIPKIEMASYDGSVITPSFTSNTAMDIAVKVKNSGDNTELGTLSVPLSFGAAVATIFDGDTTDSAVAHIIGGSAGTVFEGLVNPGRFTDQNIAYKWNGLSKAEMAGYVEKLMPGQSASTSYSGFHNWDDLSHSNYTSANKASYLSYGSGVSAGSTLVMNLNKDVAGRLEWVAPVTITVIYS

Source: E.coli

Tag Info: N-terminal 10xHis-tagged and C-terminal Myc-tagged

Expression Region: 23-277aa

Sequence Info: Full Length of Mature Protein

MW: 34.4 kDa

Purity: Greater than 90% as determined by SDS-PAGE.

Relevance: Fimbriae (also called pili), polar filaments radiating from the surface of the bacterium to a length of 0.5-1.5 micrometers and numbering 100-300 per cell, enable bacteria to colonize the epithelium of specific host organs.

Reference: "Escherichia coli F41 adhesin: genetic organization, nucleotide sequence, and homology with the K88 determinant." Anderson D.G., Moseley S.L. J. Bacteriol. 170:4890-4896(1988)

Storage: The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20?/-80?. The shelf life of lyophilized form is 12 months at -20?/-80?.

Notes: Repeated freezing and thawing is not recommended. Store working aliquots at 4? for up to one week.

Function:

Involvement in disease:

Subcellular Location:

Protein Families:

Tissue Specificity:

Paythway:

Form: Liquid or Lyophilized powder

Buffer: If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0.

Reconstitution: We recommend that this vial be briefly centrifuged prior to opening to bring the contents to the bottom. Please reconstitute protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL.We recommend to add 5-50% of glycerol (final concentration) and aliquot for long-term storage at -20?/-80?. Our default final concentration of glycerol is 50%. Customers could use it as reference.

Uniprot ID: P11900

HGNC Database Link: N/A

UniGene Database Link: N/A

KEGG Database Link: N/A

STRING Database Link: N/A

OMIM Database Link: N/A