Recombinant Escherichia coli DNA repair protein recO (recO) | CSB-EP364006ENV

Recombinant Escherichia coli DNA repair protein recO (recO) | CSB-EP364006ENV | Cusabio

Alternative Name(s): Recombination protein O

Gene Names: recO

Research Areas: Others

Organism: Escherichia coli (strain K12)

AA Sequence: MEGWQRAFVLHSRPWSETSLMLDVFTEESGRVRLVAKGARSKRSTLKGALQPFTPLLLRFGGRGEVKTLRSAEAVSLALPLSGITLYSGLYINELLSRVLEYETRFSELFFDYLHCIQSLAGVTGTPEPALRRFELALLGHLGYGVNFTHCAGSGEPVDDTMTYRYREEKGFIASVVIDNKTFTGRQLKALNAREFPDADTLRAAKRFTRMALKPYLGGKPLKSRELFRQFMPKRTVKTHYE

Source: E.coli

Tag Info: N-terminal 6xHis-SUMO-tagged

Expression Region: 1-242aa

Sequence Info: Full Length

MW: 43.4 kDa

Purity: Greater than 90% as determined by SDS-PAGE.

Relevance: Involved in DNA repair and RecF pathway recombination.

Reference: Molecular analysis of the Escherichia coli recO gene.Morrison P.T., Lovett S.T., Gilson L.E., Kolodner R.J. Bacteriol. 171:3641-3649(1989)

Storage: The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20?/-80?. The shelf life of lyophilized form is 12 months at -20?/-80?.

Notes: Repeated freezing and thawing is not recommended. Store working aliquots at 4? for up to one week.

Function: Involved in DNA repair and RecF pathway recombination.

Involvement in disease:

Subcellular Location:

Protein Families: RecO family

Tissue Specificity:

Paythway:

Form: Liquid or Lyophilized powder

Buffer: If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0.

Reconstitution: We recommend that this vial be briefly centrifuged prior to opening to bring the contents to the bottom. Please reconstitute protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL.We recommend to add 5-50% of glycerol (final concentration) and aliquot for long-term storage at -20?/-80?. Our default final concentration of glycerol is 50%. Customers could use it as reference.

Uniprot ID: P0A7H3

HGNC Database Link: N/A

UniGene Database Link: N/A

KEGG Database Link: KEGG

STRING Database Link: STRING

OMIM Database Link: N/A