Recombinant Escherichia coli CS6 fimbrial subunit B (cssB) | CSB-YP347417ENL

(No reviews yet) Write a Review
SKU:
CSB-YP347417ENL
Availability:
25 - 35 Working Days
  • Recombinant Escherichia coli CS6 fimbrial subunit B (cssB)
  • (Tris-Glycine gel) Discontinuous SDS-PAGE (reduced) with 5% enrichment gel and 15% separation gel.
£306.40 - £1,076.00

Description

Recombinant Escherichia coli CS6 fimbrial subunit B (cssB) | CSB-YP347417ENL | Cusabio

Alternative Name(s): cssBCS6 fimbrial subunit B

Gene Names: cssB

Research Areas: Others

Organism: Escherichia coli

AA Sequence: GNWQYKSLDVNVNIEQNFIPDIDSAVRIIPVNYDSDPKLNSQLYTVEMTIPAGVSAVKIVPTDSLTSSGQQIGKLVNVNNPDQNMNYYIRKDSGAGKFMAGQKGSFSVKENTSYTFSAIYTGGEYPNSGYSSGTYAGHLTVSFYSN

Source: Yeast

Tag Info: N-terminal 6xHis-tagged

Expression Region: 22-167aa

Sequence Info: Full Length of Mature Protein

MW: 17.9 kDa

Purity: Greater than 90% as determined by SDS-PAGE.

Relevance:

Reference: "Crystal structure of enterotoxigenic Escherichia coli colonization factor CS6 reveals a novel type of functional assembly."Roy S.P., Rahman M.M., Yu X.D., Tuittila M., Knight S.D., Zavialov A.V.Mol. Microbiol. 86:1100-1115(2012)

Storage: The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20?/-80?. The shelf life of lyophilized form is 12 months at -20?/-80?.

Notes: Repeated freezing and thawing is not recommended. Store working aliquots at 4? for up to one week.

Function:

Involvement in disease:

Subcellular Location: Fimbrium

Protein Families:

Tissue Specificity:

Paythway:

Form: Liquid or Lyophilized powder

Buffer: If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0.

Reconstitution: We recommend that this vial be briefly centrifuged prior to opening to bring the contents to the bottom. Please reconstitute protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL.We recommend to add 5-50% of glycerol (final concentration) and aliquot for long-term storage at -20?/-80?. Our default final concentration of glycerol is 50%. Customers could use it as reference.

Uniprot ID: P53510

HGNC Database Link: N/A

UniGene Database Link: N/A

KEGG Database Link: N/A

STRING Database Link: N/A

OMIM Database Link: N/A

View AllClose

0 Reviews

View AllClose