Recombinant Escherichia coli CFA/I fimbrial subunit B (cfaB) | CSB-EP316797ENL

(No reviews yet) Write a Review
SKU:
CSB-EP316797ENL
Availability:
13 - 23 Working Days
£281.60 - £1,361.60

Description

Recombinant Escherichia coli CFA/I fimbrial subunit B (cfaB) | CSB-EP316797ENL | Cusabio

Alternative Name(s): CFA/I antigen (CFA/I pilin) (Colonization factor antigen I subunit B) (cfaB)

Gene Names: cfaB

Research Areas: Immunology

Organism: Escherichia coli

AA Sequence: VEKNITVTASVDPAIDLLQADGNALPSAVKLAYSPASKTFESYRVMTQVHTNDATKKVIVKLADTPQLTDVLNSTVQMPISVSWGGQVLSTTAKEFEAAALGYSASGVNGVSSSQELVISAAPKTAGTAPTAGNYSGVVSLVMTLGS

Source: E.coli

Tag Info: N-terminal 10xHis-SUMO-tagged and C-terminal Myc-tagged

Expression Region: 24-170aa

Sequence Info: Full Length of Mature Protein

MW: 31.1

Purity: Greater than 85% as determined by SDS-PAGE.

Relevance: Fimbriae, polar filaments radiating from the surface of the bacterium to a length of 0.5-1.5 micrometers and numbering 100-300 per cell, enable bacteria to colonize the epithelium of specific host organs.

Reference: "The nucleotide sequence of the first two genes of the CFA/I fimbrial operon of human enterotoxigenic Escherichia coli." Hamers A.M., Pel H.J., Willshaw G.A., Kusters J.G., van der Zeijst B.A.M., Gaastra W. Microb. Pathog. 6:297-309(1989)

Storage: The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20?/-80?. The shelf life of lyophilized form is 12 months at -20?/-80?.

Notes: Repeated freezing and thawing is not recommended. Store working aliquots at 4? for up to one week.

Function:

Involvement in disease:

Subcellular Location:

Protein Families:

Tissue Specificity:

Paythway:

Form: Liquid or Lyophilized powder

Buffer: If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0.

Reconstitution: We recommend that this vial be briefly centrifuged prior to opening to bring the contents to the bottom. Please reconstitute protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL.We recommend to add 5-50% of glycerol (final concentration) and aliquot for long-term storage at -20?/-80?. Our default final concentration of glycerol is 50%. Customers could use it as reference.

Uniprot ID: P0CK93

HGNC Database Link: N/A

UniGene Database Link: N/A

KEGG Database Link: N/A

STRING Database Link: N/A

OMIM Database Link: N/A

View AllClose

0 Reviews

View AllClose