Recombinant Escherichia coli Arsenical resistance operon repressor (arsR) | CSB-EP327658ENVa0

(No reviews yet) Write a Review
SKU:
CSB-EP327658ENVa0
Availability:
13 - 23 Working Days
  • Recombinant Escherichia coli Arsenical resistance operon repressor (arsR)
  • (Tris-Glycine gel) Discontinuous SDS-PAGE (reduced) with 5% enrichment gel and 15% separation gel.
£281.60 - £1,361.60

Description

Recombinant Escherichia coli Arsenical resistance operon repressor (arsR) | CSB-EP327658ENVa0 | Cusabio

Alternative Name(s): arsE

Gene Names: arsR

Research Areas: Others

Organism: Escherichia coli (strain K12)

AA Sequence: MSFLLPIQLFKILADETRLGIVLLLSELGELCVCDLCTALDQSQPKISRHLALLRESGLLLDRKQGKWVHYRLSPHIPAWAAKIIDEAWRCEQEKVQAIVRNLARQNCSGDSKNICS

Source: E.coli

Tag Info: N-terminal 6xHis-tagged

Expression Region: 1-117aa

Sequence Info: Full Length

MW: 19.0 kDa

Purity: Greater than 90% as determined by SDS-PAGE.

Relevance: Transcriptional repressor for the arsEFG operon. ArsE is a trans-acting regulatory protein which controls its own expression. The repressive effect of ArsE is alleviated by oxyions of +III oxidation state of arsenic, antimony, and bismuth, as well as arsenate (As(V))

Reference: "An Escherichia coli chromosomal ars operon homolog is functional in arsenic detoxification and is conserved in Gram-negative bacteria." Diorio C., Cai J., Marmor J., Shinder R., Dubow M.S. J. Bacteriol. 177:2050-2056(1995)

Storage: The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20?/-80?. The shelf life of lyophilized form is 12 months at -20?/-80?.

Notes: Repeated freezing and thawing is not recommended. Store working aliquots at 4? for up to one week.

Function: Transcriptional repressor for the arsEFG operon. ArsE is a trans-acting regulatory protein which controls its own expression. The repressive effect of ArsE is alleviated by oxyions of +III oxidation state of arsenic, antimony, and bismuth, as well as arsenate (As(V)) (By similarity).

Involvement in disease:

Subcellular Location:

Protein Families:

Tissue Specificity:

Paythway:

Form: Liquid or Lyophilized powder

Buffer: If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0.

Reconstitution: We recommend that this vial be briefly centrifuged prior to opening to bring the contents to the bottom. Please reconstitute protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL.We recommend to add 5-50% of glycerol (final concentration) and aliquot for long-term storage at -20?/-80?. Our default final concentration of glycerol is 50%. Customers could use it as reference.

Uniprot ID: P37309

HGNC Database Link: N/A

UniGene Database Link: N/A

KEGG Database Link: KEGG

STRING Database Link: STRING

OMIM Database Link: N/A

View AllClose

0 Reviews

View AllClose