Cusabio Escherichia coli Recombinants
Recombinant Escherichia coli Adenylate kinase (adk) | CSB-RP163274Ba
- SKU:
 - CSB-RP163274Ba
 - Availability:
 - 13 - 23 Working Days
 
Description
Recombinant Escherichia coli Adenylate kinase (adk) | CSB-RP163274Ba | Cusabio
Alternative Name(s): ATP-AMP transphosphorylase
Gene Names: adk
Research Areas: Others
Organism: Escherichia coli (strain K12)
AA Sequence: MRIILLGAPGAGKGTQAQFIMEKYGIPQISTGDMLRAAVKSGSELGKQAKDIMDAGKLVTDELVIALVKERIAQEDCRNGFLLDGFPRTIPQADAMKEAGINVDYVLEFDVPDELIVDRIVGRRVHAPSGRVYHVKFNPPKVEGKDDVTGEELTTRKDDQEETVRKRLVEYHQMTAPLIGYYSKEAEAGNTKYAKVDGTKPVAEVRADLEKILG
Source: E.coli
Tag Info: N-terminal 6xHis-tagged
Expression Region: 1-214aa
Sequence Info: Full Length
MW: 27.6 kDa
Purity: Greater than 90% as determined by SDS-PAGE.
Relevance: Catalyzes the reversible transfer of the terminal phosphate group between ATP and AMP. Plays an important role in cellular energy homeostasis and in adenine nucleotide metabolism.
Reference: Eukaryotic Mr 83,000 heat shock protein has a homologue in Escherichia coli.Bardwell J.C.A., Craig E.A.Proc. Natl. Acad. Sci. U.S.A. 84:5177-5181(1987)
Storage: The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20?/-80?. The shelf life of lyophilized form is 12 months at -20?/-80?.
Notes: Repeated freezing and thawing is not recommended. Store working aliquots at 4? for up to one week.
Function: Catalyzes the reversible transfer of the terminal phosphate group between ATP and AMP. Plays an important role in cellular energy homeostasis and in adenine nucleotide metabolism.
Involvement in disease:
Subcellular Location: Cytoplasm
Protein Families: Adenylate kinase family
Tissue Specificity:
Paythway:
Form: Liquid or Lyophilized powder
Buffer: If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0.
Reconstitution: We recommend that this vial be briefly centrifuged prior to opening to bring the contents to the bottom. Please reconstitute protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL.We recommend to add 5-50% of glycerol (final concentration) and aliquot for long-term storage at -20?/-80?. Our default final concentration of glycerol is 50%. Customers could use it as reference.
Uniprot ID: P69441
HGNC Database Link: N/A
UniGene Database Link: N/A
KEGG Database Link: KEGG
STRING Database Link: STRING
OMIM Database Link: N/A